Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  NEDD4L WW2 DOMAIN IN COMPLEX WITH A SMAD7 DERIVED PEPTIDE
 
Authors :  M. J. Macias, E. Aragon, N. Goerner, Q. Xi, T. Lopes, S. Gao, J. Massague
Date :  04 Jun 12  (Deposition) - 21 Nov 12  (Release) - 21 Nov 12  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A,B  (30x)
NMR Structure *:  A,B  (1x)
Keywords :  Ww, Nedd4L, Smad7, Protein Binding-Peptide Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  E. Aragon, N. Goerner, Q. Xi, T. Gomes, S. Gao, J. Massague, M. J. Macias
Structural Basis For The Versatile Interactions Of Smad7 With Regulator Ww Domains In Tgf-Beta Pathways.
Structure V. 20 1726 2012
PubMed-ID: 22921829  |  Reference-DOI: 10.1016/J.STR.2012.07.014

(-) Compounds

Molecule 1 - E3 UBIQUITIN-PROTEIN LIGASE NEDD4-LIKE
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPETM11
    Expression System StrainBL21
    Expression System Taxid511693
    Expression System Vector TypePLASMID
    FragmentWW2 DOMAIN (UNP RESIDUES 385-417)
    GeneNEDD4L, KIAA0439, NEDL3
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymNEDD4.2, NEDD4-2
 
Molecule 2 - SMAD7 DERIVED PEPTIDE
    ChainsB
    EngineeredYES
    FragmentUNP RESIDUES 203-217
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SyntheticYES

 Structural Features

(-) Chains, Units

  12
NMR Structure (30x)AB
NMR Structure * (1x)AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2LTY)

(-) Sites  (0, 0)

(no "Site" information available for 2LTY)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2LTY)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2LTY)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2LTY)

(-) PROSITE Motifs  (2, 2)

NMR Structure (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1WW_DOMAIN_2PS50020 WW/rsp5/WWP domain profile.NED4L_HUMAN193-226
385-418
497-530
548-581
  1-
A:365-397
-
-
2WW_DOMAIN_1PS01159 WW/rsp5/WWP domain signature.NED4L_HUMAN199-224
391-416
503-528
554-579
  1-
A:371-396
-
-
NMR Structure * (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1WW_DOMAIN_2PS50020 WW/rsp5/WWP domain profile.NED4L_HUMAN193-226
385-418
497-530
548-581
  1-
A:365-397
-
-
2WW_DOMAIN_1PS01159 WW/rsp5/WWP domain signature.NED4L_HUMAN199-224
391-416
503-528
554-579
  1-
A:371-396
-
-

(-) Exons   (3, 3)

NMR Structure (3, 3)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000002621581ENSE00001243795chr18:46477081-46476182900SMAD7_HUMAN1-2052051B:203-2053
1.2ENST000002621582ENSE00000669021chr18:46474807-4647475454SMAD7_HUMAN205-223191B:205-21713
1.3ENST000002621583ENSE00000669023chr18:46468925-4646885175SMAD7_HUMAN223-248260--
1.4ENST000002621584ENSE00001243787chr18:46448280-464462232058SMAD7_HUMAN248-4261790--

2.1ENST000004003451ENSE00001683001chr18:55711619-55711940322NED4L_HUMAN1-16160--
2.4ENST000004003454ENSE00001648238chr18:55833020-5583309374NED4L_HUMAN17-41250--
2.8ENST000004003458ENSE00001615561chr18:55912659-5591274082NED4L_HUMAN41-68280--
2.9ENST000004003459ENSE00001662674chr18:55916131-5591616939NED4L_HUMAN69-81130--
2.10ENST0000040034510ENSE00001795248chr18:55919233-5591928654NED4L_HUMAN82-99180--
2.11ENST0000040034511ENSE00001721236chr18:55983214-5598326451NED4L_HUMAN100-116170--
2.12ENST0000040034512ENSE00001691252chr18:55989657-5598971862NED4L_HUMAN117-137210--
2.13ENST0000040034513ENSE00001159817chr18:55990464-55990566103NED4L_HUMAN137-171350--
2.14ENST0000040034514ENSE00001159809chr18:55992228-55992394167NED4L_HUMAN172-227560--
2.15ENST0000040034515ENSE00001159803chr18:55996227-55996359133NED4L_HUMAN227-271450--
2.16ENST0000040034516ENSE00001159795chr18:55997970-55998146177NED4L_HUMAN272-330590--
2.17ENST0000040034517ENSE00000807241chr18:56001050-5600112475NED4L_HUMAN331-355250--
2.18ENST0000040034518ENSE00000914600chr18:56002710-5600276960NED4L_HUMAN356-375200--
2.19ENST0000040034519ENSE00000914602chr18:56008270-56008401132NED4L_HUMAN376-419441A:365-39834
2.20ENST0000040034520ENSE00000807243chr18:56008910-56009029120NED4L_HUMAN420-459400--
2.21ENST0000040034521ENSE00000669702chr18:56010138-56010335198NED4L_HUMAN460-525660--
2.22ENST0000040034522ENSE00000914615chr18:56016769-5601684678NED4L_HUMAN526-551260--
2.23ENST0000040034523ENSE00000914622chr18:56018223-5601827755NED4L_HUMAN552-570190--
2.24ENST0000040034524ENSE00000807247chr18:56024426-5602448459NED4L_HUMAN570-589200--
2.25ENST0000040034525ENSE00000914638chr18:56031500-5603156566NED4L_HUMAN590-611220--
2.26ENST0000040034526ENSE00000807249chr18:56033231-56033460230NED4L_HUMAN612-688770--
2.27ENST0000040034527ENSE00000914645chr18:56034978-56035099122NED4L_HUMAN688-729420--
2.28ENST0000040034528ENSE00000669736chr18:56037629-5603769971NED4L_HUMAN729-752240--
2.29ENST0000040034529ENSE00000486414chr18:56040406-5604050196NED4L_HUMAN753-784320--
2.30ENST0000040034530ENSE00000914660chr18:56050478-5605055174NED4L_HUMAN785-809250--
2.31ENST0000040034531ENSE00000914663chr18:56052758-5605281861NED4L_HUMAN809-829210--
2.32ENST0000040034532ENSE00000914668chr18:56054671-5605473060NED4L_HUMAN830-849200--
2.33ENST0000040034533ENSE00000914673chr18:56056317-56056424108NED4L_HUMAN850-885360--
2.34ENST0000040034534ENSE00001649725chr18:56057878-5605797497NED4L_HUMAN886-918330--
2.35ENST0000040034535ENSE00000914685chr18:56058719-5605879173NED4L_HUMAN918-942250--
2.36ENST0000040034536ENSE00001341470chr18:56063399-560687725374NED4L_HUMAN942-975340--

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:34
 aligned with NED4L_HUMAN | Q96PU5 from UniProtKB/Swiss-Prot  Length:975

    Alignment length:34
                                   394       404       414    
          NED4L_HUMAN   385 PGLPSGWEERKDAKGRTYYVNHNNRTTTWTRPIM 418
               SCOP domains ---------------------------------- SCOP domains
               CATH domains ---------------------------------- CATH domains
               Pfam domains ---------------------------------- Pfam domains
         Sec.struct. author ......eeeeee...eeeeee....eee...... Sec.struct. author
                 SAPs(SNPs) ---------------------------------- SAPs(SNPs)
                PROSITE (1) WW_DOMAIN_2  PDB: A:365-397        PROSITE (1)
                PROSITE (2) ------WW_DOMAIN_1  PDB: A:371-39-- PROSITE (2)
               Transcript 2 Exon 2.19  PDB: A:365-398          Transcript 2
                 2lty A 365 PGLPSGWEERKDAKGRTYYVNHNNRTTTWTRPIG 398
                                   374       384       394    

Chain B from PDB  Type:PROTEIN  Length:15
 aligned with SMAD7_HUMAN | O15105 from UniProtKB/Swiss-Prot  Length:426

    Alignment length:15
                                   212     
          SMAD7_HUMAN   203 ELESPPPPYSRYPMD 217
               SCOP domains --------------- SCOP domains
               CATH domains --------------- CATH domains
               Pfam domains --------------- Pfam domains
         Sec.struct. author ............... Sec.struct. author
                 SAPs(SNPs) --------------- SAPs(SNPs)
                    PROSITE --------------- PROSITE
           Transcript 1 (1) 1.1------------ Transcript 1 (1)
           Transcript 1 (2) --Exon 1.2      Transcript 1 (2)
                 2lty B 203 ELESPPPPYSRYPMD 217
                                   212     

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2LTY)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2LTY)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2LTY)

(-) Gene Ontology  (100, 108)

NMR Structure(hide GO term definitions)
Chain A   (NED4L_HUMAN | Q96PU5)
molecular function
    GO:0044325    ion channel binding    Interacting selectively and non-covalently with one or more specific sites on an ion channel, a protein complex that spans a membrane and forms a water-filled channel across the phospholipid bilayer allowing selective ion transport down its electrochemical gradient.
    GO:0016874    ligase activity    Catalysis of the joining of two substances, or two groups within a single molecule, with the concomitant hydrolysis of the diphosphate bond in ATP or a similar triphosphate.
    GO:0019870    potassium channel inhibitor activity    Stops, prevents, or reduces the activity of a potassium channel.
    GO:0015459    potassium channel regulator activity    Modulates potassium channel activity via direct interaction interaction with a potassium channel (binding or modification).
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0019871    sodium channel inhibitor activity    Stops, prevents, or reduces the activity of a sodium channel.
    GO:0017080    sodium channel regulator activity    Modulates the activity of a sodium channel.
    GO:0004842    ubiquitin-protein transferase activity    Catalysis of the transfer of ubiquitin from one protein to another via the reaction X-Ub + Y --> Y-Ub + X, where both X-Ub and Y-Ub are covalent linkages.
biological process
    GO:0030154    cell differentiation    The process in which relatively unspecialized cells, e.g. embryonic or regenerative cells, acquire specialized structural and/or functional features that characterize the cells, tissues, or organs of the mature organism or some other relatively stable phase of the organism's life history. Differentiation includes the processes involved in commitment of a cell to a specific fate and its subsequent development to the mature state.
    GO:0006883    cellular sodium ion homeostasis    Any process involved in the maintenance of an internal steady state of sodium ions at the level of a cell.
    GO:0007588    excretion    The elimination by an organism of the waste products that arise as a result of metabolic activity. These products include water, carbon dioxide (CO2), and nitrogenous compounds.
    GO:0034220    ion transmembrane transport    A process in which an ion is transported from one side of a membrane to the other by means of some agent such as a transporter or pore.
    GO:1901380    negative regulation of potassium ion transmembrane transport    Any process that stops, prevents or reduces the frequency, rate or extent of potassium ion transmembrane transport.
    GO:1901017    negative regulation of potassium ion transmembrane transporter activity    Any process that stops, prevents or reduces the frequency, rate or extent of potassium ion transmembrane transporter activity.
    GO:2000009    negative regulation of protein localization to cell surface    Any process that stops, prevents, or reduces the frequency, rate or extent of protein localization to the cell surface.
    GO:1902306    negative regulation of sodium ion transmembrane transport    Any process that stops, prevents or reduces the frequency, rate or extent of sodium ion transmembrane transport.
    GO:2000650    negative regulation of sodium ion transmembrane transporter activity    Any process that stops, prevents or reduces the frequency, rate or extent of sodium ion transmembrane transporter activity.
    GO:0000122    negative regulation of transcription from RNA polymerase II promoter    Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:2001288    positive regulation of caveolin-mediated endocytosis    Any process that activates or increases the frequency, rate or extent of caveolin-mediated endocytosis.
    GO:1903861    positive regulation of dendrite extension    Any process that activates or increases the frequency, rate or extent of dendrite extension.
    GO:0045807    positive regulation of endocytosis    Any process that activates or increases the frequency, rate or extent of endocytosis.
    GO:0045732    positive regulation of protein catabolic process    Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the breakdown of a protein by the destruction of the native, active configuration, with or without the hydrolysis of peptide bonds.
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0070936    protein K48-linked ubiquitination    A protein ubiquitination process in which a polymer of ubiquitin, formed by linkages between lysine residues at position 48 of the ubiquitin monomers, is added to a protein. K48-linked ubiquitination targets the substrate protein for degradation.
    GO:0006513    protein monoubiquitination    Addition of a single ubiquitin group to a protein.
    GO:0000209    protein polyubiquitination    Addition of multiple ubiquitin groups to a protein, forming a ubiquitin chain.
    GO:0016567    protein ubiquitination    The process in which one or more ubiquitin groups are added to a protein.
    GO:0042787    protein ubiquitination involved in ubiquitin-dependent protein catabolic process    The process in which a ubiquitin group, or multiple groups, are covalently attached to the target protein, thereby initiating the degradation of that protein.
    GO:0034765    regulation of ion transmembrane transport    Any process that modulates the frequency, rate or extent of the directed movement of ions from one side of a membrane to the other.
    GO:0003254    regulation of membrane depolarization    Any process that modulates the rate, frequency or extent of membrane depolarization. Membrane depolarization is the process in which membrane potential changes in the depolarizing direction from the resting potential, usually from negative to positive.
    GO:0042391    regulation of membrane potential    Any process that modulates the establishment or extent of a membrane potential, the electric potential existing across any membrane arising from charges in the membrane itself and from the charges present in the media on either side of the membrane.
    GO:0060306    regulation of membrane repolarization    Any process that modulates the establishment or extent of a membrane potential in the polarizing direction towards the resting potential, usually from positive to negative.
    GO:1901016    regulation of potassium ion transmembrane transporter activity    Any process that modulates the frequency, rate or extent of potassium ion transmembrane transporter activity.
    GO:0042176    regulation of protein catabolic process    Any process that modulates the frequency, rate or extent of the chemical reactions and pathways resulting in the breakdown of a protein by the destruction of the native, active configuration, with or without the hydrolysis of peptide bonds.
    GO:0010038    response to metal ion    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a metal ion stimulus.
    GO:0006814    sodium ion transport    The directed movement of sodium ions (Na+) into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0086005    ventricular cardiac muscle cell action potential    An action potential that occurs in a ventricular cardiac muscle cell.
    GO:0019058    viral life cycle    A set of processes which all viruses follow to ensure survival; includes attachment and entry of the virus particle, decoding of genome information, translation of viral mRNA by host ribosomes, genome replication, and assembly and release of viral particles containing the genome.
    GO:0016032    viral process    A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
    GO:0030104    water homeostasis    Any process involved in the maintenance of an internal steady state of water within an organism or cell.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Chain B   (SMAD7_HUMAN | O15105)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0070411    I-SMAD binding    Interacting selectively and non-covalently with an inhibitory SMAD signaling protein.
    GO:0048185    activin binding    Interacting selectively and non-covalently with activin, a dimer of inhibin-beta subunits.
    GO:0008013    beta-catenin binding    Interacting selectively and non-covalently with the beta subunit of the catenin complex.
    GO:0005518    collagen binding    Interacting selectively and non-covalently with collagen, a group of fibrous proteins of very high tensile strength that form the main component of connective tissue in animals. Collagen is highly enriched in glycine (some regions are 33% glycine) and proline, occurring predominantly as 3-hydroxyproline (about 20%).
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0003700    transcription factor activity, sequence-specific DNA binding    Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
    GO:0044212    transcription regulatory region DNA binding    Interacting selectively and non-covalently with a DNA region that regulates the transcription of a region of DNA, which may be a gene, cistron, or operon. Binding may occur as a sequence specific interaction or as an interaction observed only once a factor has been recruited to the DNA by other factors.
    GO:0030617    transforming growth factor beta receptor, inhibitory cytoplasmic mediator activity    A TGF-beta cytoplasmic mediator that inhibits the signaling function of common-partner and pathway-specific mediators.
    GO:0034713    type I transforming growth factor beta receptor binding    Interacting selectively and non-covalently with a type I transforming growth factor beta receptor.
    GO:0031625    ubiquitin protein ligase binding    Interacting selectively and non-covalently with a ubiquitin protein ligase enzyme, any of the E3 proteins.
biological process
    GO:0030509    BMP signaling pathway    A series of molecular signals initiated by the binding of a member of the BMP (bone morphogenetic protein) family to a receptor on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0034333    adherens junction assembly    The aggregation, arrangement and bonding together of a set of components to form an adherens junction. An adherens junction is a cell junction at which the cytoplasmic face of the plasma membrane is attached to actin filaments.
    GO:0048844    artery morphogenesis    The process in which the anatomical structures of arterial blood vessels are generated and organized. Arteries are blood vessels that transport blood from the heart to the body and its organs.
    GO:0034629    cellular protein complex localization    A protein complex localization process that takes place at the cellular level; as a result, a protein complex is transported to, or maintained in, a specific location within a cell.
    GO:0071560    cellular response to transforming growth factor beta stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a transforming growth factor beta stimulus.
    GO:0035556    intracellular signal transduction    The process in which a signal is passed on to downstream components within the cell, which become activated themselves to further propagate the signal and finally trigger a change in the function or state of the cell.
    GO:0030514    negative regulation of BMP signaling pathway    Any process that stops, prevents, or reduces the frequency, rate or extent of the BMP signaling pathway.
    GO:0030336    negative regulation of cell migration    Any process that stops, prevents, or reduces the frequency, rate or extent of cell migration.
    GO:0010719    negative regulation of epithelial to mesenchymal transition    Any process that decreases the rate, frequency, or extent of epithelial to mesenchymal transition. Epithelial to mesenchymal transition where an epithelial cell loses apical/basolateral polarity, severs intercellular adhesive junctions, degrades basement membrane components and becomes a migratory mesenchymal cell.
    GO:0060394    negative regulation of pathway-restricted SMAD protein phosphorylation    Any process that decreases the rate, frequency or extent of pathway-restricted SMAD protein phosphorylation. Pathway-restricted SMAD proteins and common-partner SMAD proteins are involved in the transforming growth factor beta receptor signaling pathways.
    GO:0033137    negative regulation of peptidyl-serine phosphorylation    Any process that stops, prevents, or reduces the frequency, rate or extent of the phosphorylation of peptidyl-serine.
    GO:0010801    negative regulation of peptidyl-threonine phosphorylation    Any process that decreases the frequency, rate or extent of peptidyl-threonine phosphorylation. Peptidyl-threonine phosphorylation is the phosphorylation of peptidyl-threonine to form peptidyl-O-phospho-L-threonine.
    GO:0031397    negative regulation of protein ubiquitination    Any process that stops, prevents, or reduces the frequency, rate or extent of the addition of ubiquitin groups to a protein.
    GO:0043433    negative regulation of sequence-specific DNA binding transcription factor activity    Any process that stops, prevents, or reduces the frequency, rate or extent of the activity of a transcription factor, any factor involved in the initiation or regulation of transcription.
    GO:0010944    negative regulation of transcription by competitive promoter binding    Any process that stops, prevents, or reduces the frequency, rate or extent of DNA-dependent transcription using a mechanism that involves direct competition for interaction with a promoter binding site.
    GO:0000122    negative regulation of transcription from RNA polymerase II promoter    Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0045892    negative regulation of transcription, DNA-templated    Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0030512    negative regulation of transforming growth factor beta receptor signaling pathway    Any process that stops, prevents, or reduces the frequency, rate or extent of any TGF-beta receptor signaling pathway.
    GO:0051444    negative regulation of ubiquitin-protein transferase activity    Any process that stops, prevents, or reduces the frequency, rate or extent of ubiquitin transferase activity.
    GO:0060389    pathway-restricted SMAD protein phosphorylation    The process of introducing a phosphate group on to a pathway restricted SMAD protein. A pathway restricted SMAD protein is an effector protein that acts directly downstream of the transforming growth factor family receptor.
    GO:0022409    positive regulation of cell-cell adhesion    Any process that activates or increases the rate or extent of cell adhesion to another cell.
    GO:0032436    positive regulation of proteasomal ubiquitin-dependent protein catabolic process    Any process that activates or increases the frequency, rate or extent of the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0031398    positive regulation of protein ubiquitination    Any process that activates or increases the frequency, rate or extent of the addition of ubiquitin groups to a protein.
    GO:0045944    positive regulation of transcription from RNA polymerase II promoter    Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0050821    protein stabilization    Any process involved in maintaining the structure and integrity of a protein and preventing it from degradation or aggregation.
    GO:0032925    regulation of activin receptor signaling pathway    Any process that modulates the frequency, rate or extent of the activity of any activin receptor signaling pathway.
    GO:0055117    regulation of cardiac muscle contraction    Any process that modulates the frequency, rate or extent of cardiac muscle contraction.
    GO:0010717    regulation of epithelial to mesenchymal transition    Any process that modulates the rate, frequency, or extent of epithelial to mesenchymal transition. Epithelial to mesenchymal transition where an epithelial cell loses apical/basolateral polarity, severs intercellular adhesive junctions, degrades basement membrane components and becomes a migratory mesenchymal cell.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0017015    regulation of transforming growth factor beta receptor signaling pathway    Any process that modulates the frequency, rate or extent of activity of any TGF-beta receptor signaling pathway.
    GO:0060373    regulation of ventricular cardiac muscle cell membrane depolarization    Any process that modulates the establishment or extent of a membrane potential in the depolarizing direction away from the resting potential in a ventricular cardiomyocyte.
    GO:0034616    response to laminar fluid shear stress    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a laminar fluid shear stress stimulus. Laminar fluid flow is the force acting on an object in a system where the fluid is moving across a solid surface in parallel layers. As an example, laminar shear stress can be seen where blood flows against the luminal side of blood vessel walls.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
    GO:0007179    transforming growth factor beta receptor signaling pathway    A series of molecular signals initiated by the binding of an extracellular ligand to a transforming growth factor beta receptor on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0001657    ureteric bud development    The process whose specific outcome is the progression of the ureteric bud over time, from its formation to the mature structure.
    GO:0055010    ventricular cardiac muscle tissue morphogenesis    The process in which the anatomical structures of cardiac ventricle muscle is generated and organized.
    GO:0060412    ventricular septum morphogenesis    The developmental process in which a ventricular septum is generated and organized. A ventricular septum is an anatomical structure that separates the lower chambers (ventricles) of the heart from one another.
cellular component
    GO:0016342    catenin complex    Complex of peripheral cytoplasmic proteins (alpha-, beta- and gamma-catenin) that interact with the cytoplasmic region of uvomorulin/E-cadherin to connect it to the actin cytoskeleton.
    GO:0005913    cell-cell adherens junction    An adherens junction which connects a cell to another cell.
    GO:0005813    centrosome    A structure comprised of a core structure (in most organisms, a pair of centrioles) and peripheral material from which a microtubule-based structure, such as a spindle apparatus, is organized. Centrosomes occur close to the nucleus during interphase in many eukaryotic cells, though in animal cells it changes continually during the cell-division cycle.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0005730    nucleolus    A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0043234    protein complex    A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.
    GO:0005667    transcription factor complex    A protein complex that is capable of associating with DNA by direct binding, or via other DNA-binding proteins or complexes, and regulating transcription.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2lty)
 
  Sites
(no "Sites" information available for 2lty)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2lty)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2lty
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  NED4L_HUMAN | Q96PU5
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  SMAD7_HUMAN | O15105
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  NED4L_HUMAN | Q96PU5
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  SMAD7_HUMAN | O15105
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        NED4L_HUMAN | Q96PU52laj 2lb2 2mpt 2nsq 2oni 3jvz 3jw0 5hpk
        SMAD7_HUMAN | O151052djy 2kxq 2ltv 2ltw 2ltx 2ltz

(-) Related Entries Specified in the PDB File

2ltv 2ltw 2ltx 2ltz