Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Theoretical Model
(-)Theor. Model - sites
collapse expand < >
Image Theoretical Model
Theoretical Model  (Jmol Viewer)
Image Theor. Model - sites
Theor. Model - sites  (Jmol Viewer)

(-) Description

Title :  IMMUNOGLOBULIN LAMBDA LIGHT CHAIN DIMER LOI FROM A HUMAN PATIENT
 
Authors :  T. S. Jokiranta, A. Solomon, M. K. Pangburn, P. F. Zipfel, S. Meri
Date :  09 Mar 99  (Deposition) - 29 Dec 99  (Release) - 26 Sep 01  (Revision)
Method :  THEORETICAL MODEL
Resolution :  NOT APPLICABLE
Chains :  Theor. Model :  A,B
Keywords :  Theoretical Molecular Model, Complement, Autoantibody, Autoimmunity, Antigen Binding, Human, Factor H (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  T. S. Jokiranta, A. Solomon, M. K. Pangburn, P. F. Zipfel, S. Meri
Nephritogenic Lambda Light Chain Dimer: A Unique Human Miniautoantibody Against Complement Factor H.
J. Immunol. V. 163 4590 1999
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PROTEIN (IMMUNOGLOBULIN LOI)
    ChainsA, B
    FragmentLAMBDA LIGHT CHAIN DIMER-VARIABLE DOMAIN
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    SecretionSERUM
    SynonymLAMBDA-L

 Structural Features

(-) Chains, Units

  
Theoretical Model 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2LOI)

(-) Sites  (1, 1)

Theoretical Model (1, 1)
No.NameEvidenceResiduesDescription
1FH3not definedTYR A:47 , PHE A:48 , ARG A:50 , ASP A:51 , TRP A:89 , GLU A:94 , GLU B:29 , TYR B:47 , PHE B:48 , ARG B:50 , TRP B:89 , GLU B:94

(-) SS Bonds  (2, 2)

Theoretical Model
No.Residues
1A:21 -A:86
2B:21 -B:86

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2LOI)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2LOI)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2LOI)

(-) Exons   (1, 2)

Theoretical Model (1, 2)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000003903081ENSE00001910000chr22:23054174-23054290117LV321_HUMAN-00--
1.2ENST000003903082ENSE00001857372chr22:23054770-23054949180LV321_HUMAN1-16160--
1.3ENST000003903083ENSE00001879509chr22:23055384-23055688305LV321_HUMAN16-1161012A:1-96
B:1-96
96
96

(-) Sequences/Alignments

Theoretical Model
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:111
 aligned with LV321_HUMAN | P80748 from UniProtKB/Swiss-Prot  Length:117

    Alignment length:111
                                                                                                                          117              
                                    30        40        50        60        70        80        90       100       110      |  -         - 
          LV321_HUMAN    21 YVLTQPPSVSVAPGQTARITCGGNNIGSKSVHWYQQKPGQAPVLVVYDDSDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSDHPT--------------   -
               SCOP domains --------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...............eeeeeee.........eeeeee...eeeeee.............ee..ee..eeeeeee.......eeeeeee........ee...eee....... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.3  PDB: A:1-96 UniProt: 16-116 [INCOMPLETE]                                              --------------- Transcript 1
                 2loi A   1 YVLTQPPSVSVAPGETARITCGGNDIGSESVHWYQQKPGQAPVLVIYFDRDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQLWDSSSEHVVFGGGTKLTVLSQPK 111
                                    10        20        30        40        50        60        70        80        90       100       110 

Chain B from PDB  Type:PROTEIN  Length:111
 aligned with LV321_HUMAN | P80748 from UniProtKB/Swiss-Prot  Length:117

    Alignment length:111
                                                                                                                          117              
                                    30        40        50        60        70        80        90       100       110      |  -         - 
          LV321_HUMAN    21 YVLTQPPSVSVAPGQTARITCGGNNIGSKSVHWYQQKPGQAPVLVVYDDSDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSDHPT--------------   -
               SCOP domains --------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........ee....eeeeee..........eeeee......eeee...............eee....eeeeee........eeeeeee......eee...ee.ee..... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.3  PDB: B:1-96 UniProt: 16-116 [INCOMPLETE]                                              --------------- Transcript 1
                 2loi B   1 YVLTQPPSVSVAPGETARITCGGNDIGSESVHWYQQKPGQAPVLVIYFDRDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQLWDSSSEHVVFGGGTKLTVLSQPK 111
                                    10        20        30        40        50        60        70        80        90       100       110 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2LOI)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2LOI)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2LOI)

(-) Gene Ontology  (14, 14)

Theoretical Model(hide GO term definitions)
Chain A,B   (LV321_HUMAN | P80748)
molecular function
    GO:0003823    antigen binding    Interacting selectively and non-covalently with an antigen, any substance which is capable of inducing a specific immune response and of reacting with the products of that response, the specific antibody or specifically sensitized T-lymphocytes, or both. Binding may counteract the biological activity of the antigen.
    GO:0004252    serine-type endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
biological process
    GO:0038095    Fc-epsilon receptor signaling pathway    A series of molecular signals initiated by the binding of the Fc portion of immunoglobulin E (IgE) to an Fc-epsilon receptor on the surface of a signal-receiving cell, and ending with regulation of a downstream cellular process, e.g. transcription. The Fc portion of an immunoglobulin is its C-terminal constant region.
    GO:0038096    Fc-gamma receptor signaling pathway involved in phagocytosis    An Fc-gamma receptor signaling pathway that contributes to the endocytic engulfment of external particulate material by phagocytes.
    GO:0006956    complement activation    Any process involved in the activation of any of the steps of the complement cascade, which allows for the direct killing of microbes, the disposal of immune complexes, and the regulation of other immune processes; the initial steps of complement activation involve one of three pathways, the classical pathway, the alternative pathway, and the lectin pathway, all of which lead to the terminal complement pathway.
    GO:0006958    complement activation, classical pathway    Any process involved in the activation of any of the steps of the classical pathway of the complement cascade which allows for the direct killing of microbes, the disposal of immune complexes, and the regulation of other immune processes.
    GO:0006955    immune response    Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0006898    receptor-mediated endocytosis    An endocytosis process in which cell surface receptors ensure specificity of transport. A specific receptor on the cell surface binds tightly to the extracellular macromolecule (the ligand) that it recognizes; the plasma-membrane region containing the receptor-ligand complex then undergoes endocytosis, forming a transport vesicle containing the receptor-ligand complex and excluding most other plasma-membrane proteins. Receptor-mediated endocytosis generally occurs via clathrin-coated pits and vesicles.
    GO:0050776    regulation of immune response    Any process that modulates the frequency, rate or extent of the immune response, the immunological reaction of an organism to an immunogenic stimulus.
cellular component
    GO:0072562    blood microparticle    A phospholipid microvesicle that is derived from any of several cell types, such as platelets, blood cells, endothelial cells, or others, and contains membrane receptors as well as other proteins characteristic of the parental cell. Microparticles are heterogeneous in size, and are characterized as microvesicles free of nucleic acids.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

Theoretical Model
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2loi)
 
  Sites
    FH3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2loi)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2loi
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  LV321_HUMAN | P80748
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  LV321_HUMAN | P80748
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2LOI)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2LOI)