|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2LLK) |
Sites (0, 0)| (no "Site" information available for 2LLK) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2LLK) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2LLK) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2LLK) |
PROSITE Motifs (2, 2)
NMR Structure (2, 2)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2LLK) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:55 aligned with DMTF1_HUMAN | Q9Y222 from UniProtKB/Swiss-Prot Length:760 Alignment length:55 229 239 249 259 269 DMTF1_HUMAN 220 DRNHVGKYTPEEIEKLKELRIKHGNDWATIGAALGRSASSVKDRCRLMKDTCNTG 274 SCOP domains ------------------------------------------------------- SCOP domains CATH domains ------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------- SAPs(SNPs) PROSITE (1) -----MYB_LIKE PDB: A:225-263 ----MYB_LIK PROSITE (1) PROSITE (2) ------------------------------------------------HTH_MYB PROSITE (2) Transcript ------------------------------------------------------- Transcript 2llk A 220 DRNHVGKYTPEEIEKLKELRIKHGNDWATIGAALGRSASSVKDRCRLMKDTCNTG 274 229 239 249 259 269
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2LLK) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2LLK) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2LLK) |
Gene Ontology (8, 8)|
NMR Structure(hide GO term definitions) Chain A (DMTF1_HUMAN | Q9Y222)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|