Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - model 1, sites
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - model 1, sites
NMR Structure - model 1, sites  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  NMR STRUCTURE OF HMG-ACPI DOMAIN FROM CURA MODULE FROM LYNGBYA MAJUSCULA
 
Authors :  A. E. Busche, D. Gottstein, C. Hein, N. Ripin, I. Pader, P. Tufar, E. B. Ei L. Gu, C. T. Walsh, F. Loehr, D. H. Sherman, P. Guntert, V. Dotsch
Date :  01 Sep 11  (Deposition) - 21 Dec 11  (Release) - 14 Mar 12  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
NMR Structure *:  A  (1x)
Keywords :  Pks, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. Busche, D. Gottstein, C. Hein, N. Ripin, I. Pader, P. Tufar, E. B. Eisman, L. Gu, C. T. Walsh, D. H. Sherman, F. Lohr, P. Guntert, V. Dotsch
Characterization Of Molecular Interactions Between Acp And Halogenase Domains In The Curacin A Polyketide Synthase.
Acs Chem. Biol. V. 7 378 2012
PubMed-ID: 22103656  |  Reference-DOI: 10.1021/CB200352Q

(-) Compounds

Molecule 1 - CURA
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: BL21
    Expression System Taxid: 511693
    Expression System Vector: PET28A
    Fragment: UNP RESIDUES 1946-2034
    Gene: CURA
    Organism Scientific: LYNGBYA MAJUSCULA
    Organism Taxid: 158786

 Structural Features

(-) Chains, Units

  1
NMR Structure (20x): A
NMR Structure * (1x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 2)

NMR Structure (2, 2)
No.NameCountTypeFull Name
1MAH1Ligand/Ion3-HYDROXY-3-METHYL-GLUTARIC ACID
2PNS1Ligand/Ion4'-PHOSPHOPANTETHEINE
NMR Structure * (2, 2)
No.NameCountTypeFull Name
1MAH1Ligand/Ion3-HYDROXY-3-METHYL-GLUTARIC ACID
2PNS1Ligand/Ion4'-PHOSPHOPANTETHEINE

(-) Sites  (2, 2)

NMR Structure (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWARESER A:1989 , VAL A:1993 , LYS A:2008 , ALA A:2009 , TYR A:2013 , MAH A:2200BINDING SITE FOR RESIDUE PNS A 2100
2AC2SOFTWAREPNS A:2100BINDING SITE FOR RESIDUE MAH A 2200

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2LIW)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2LIW)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2LIW)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2LIW)

(-) Exons   (0, 0)

(no "Exon" information available for 2LIW)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:99
 aligned with Q6DNF2_9CYAN | Q6DNF2 from UniProtKB/TrEMBL  Length:2311

    Alignment length:146
                                  1898      1908      1918      1928      1938      1948      1958      1968      1978      1988      1998      2008      2018      2028      
        Q6DNF2_9CYAN   1889 SRAVQKGLKSPYLRDIPHVQQTLAARMAAGAISFEETPSISSAPQTQQPLKTLQPLRTPQVNQVNLSEIKQVLKQQLAEALYTEESEIAEDQKFVDLGLDSIVGVEWTTTINQTYNLNLKATKLYDYPTLLELSGYIAQILSSQGT 2034
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......-----------------...------------------------------.......hhhhhhhhhhhhhhhhh...........hhhhhh.hhhhhhhhhhhhhhhhh...hhhhhhhh.hhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2liw A 1936 SGLVPRG-----------------SHM------------------------------TPQVNQVNLSEIKQVLKQQLAEALYTEESEIAEDQKFVDLGLDSIVGVEWTTTINQTYNLNLKATKLYDYPTLLELSGYIAQILSSQGT 2034
                                  |  -         -    | |  -         -         -      1948      1958      1968      1978      1988      1998      2008      2018      2028      
                               1942              1943 |                           1946                                                                                        
                                                   1945
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2LIW)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2LIW)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2LIW)

(-) Gene Ontology  (5, 5)

NMR Structure(hide GO term definitions)
Chain A   (Q6DNF2_9CYAN | Q6DNF2)
molecular function
    GO:0008080    N-acetyltransferase activity    Catalysis of the transfer of an acetyl group to a nitrogen atom on the acceptor molecule.
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0031177    phosphopantetheine binding    Interacting selectively and non-covalently with phosphopantetheine, the vitamin pantetheine 4'-(dihydrogen phosphate).
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MAH  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PNS  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2liw)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - model 1, sites PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2liw
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q6DNF2_9CYAN | Q6DNF2
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q6DNF2_9CYAN | Q6DNF2
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q6DNF2_9CYAN | Q6DNF2: 2liu 2ree 2ref 3nnf 3nnj 3nnl 3nnm

(-) Related Entries Specified in the PDB File

2liu