Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION NMR STRUCTURE OF PROTEIN RMET_5065 FROM RALSTONIA METALLIDURANS, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET CRR115
 
Authors :  T. A. Ramelot, Y. Yang, D. Wang, C. Ciccosanti, H. Janjua, R. Nair, T. B. A R. Xiao, J. K. Everett, G. T. Montelione, M. A. Kennedy, Northeast Str Genomics Consortium (Nesg)
Date :  29 Apr 11  (Deposition) - 18 May 11  (Release) - 18 May 11  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
NMR Structure *:  A  (1x)
Keywords :  Start Domain, Structural Genomics, Northeast Structural Genomics Consortium, Nesg, Unknown Function, Ahsa1, Psi-Biology (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  T. A. Ramelot, Y. Yang, J. R. Cort, D. Wang, C. Ciccosanti, H. Janjua, N. Rajesh, T. B. Acton, R. Xiao, J. K. Everett, G. T. Montelione, M. A. Kennedy
Solution Nmr Structure Of Protein Rmet_5065 From Ralstonia Metallidurans. Northeast Structural Genomics Consortium Target Crr115.
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - UNCHARACTERIZED PROTEIN
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainBL21 (DE3) + MAGIC
    Expression System Taxid469008
    Expression System VectorPET21
    GeneRMET_5065
    Organism ScientificRALSTONIA METALLIDURANS
    Organism Taxid266264
    StrainCH34 / ATCC 43123 / DSM 2839

 Structural Features

(-) Chains, Units

  1
NMR Structure (20x)A
NMR Structure * (1x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2LCG)

(-) Sites  (0, 0)

(no "Site" information available for 2LCG)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2LCG)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2LCG)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2LCG)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2LCG)

(-) Exons   (0, 0)

(no "Exon" information available for 2LCG)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:142
 aligned with Q1LD49_CUPMC | Q1LD49 from UniProtKB/TrEMBL  Length:134

    Alignment length:142
                                                                                                                                                               134        
                                    10        20        30        40        50        60        70        80        90       100       110       120       130   |     -  
         Q1LD49_CUPMC     1 MNITVETTVAAPVGKVWRAYTTPEDIKQWNAASDDWHTTAATVDLREGGAFSSRMEAKDGSMGFDFAGTYTKVVENKRIEYAFGDRTAKVEFLEAPQGVTVRVSFVAETEYPVEQQQQGWQAILNNFKRHVESH--------   -
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeee..hhhhhhhhh.hhhhhhhhh.....eee...ee......eeeeeeee.....eeeeeeeeeeee...eeeeee..eeeeeeeeee..eeeeeeeee.....hhhhhhhhhhhhhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2lcg A   1 MNITVETTVAAPVGKVWRAYTTPEDIKQWNAASDDWHTTAATVDLREGGAFSSRMEAKDGSMGFDFAGTYTKVVENKRIEYAFGDRTAKVEFLEAPQGVTVRVSFVAETEYPVEQQQQGWQAILNNFKRHVESHLEHHHHHH 142
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140  

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2LCG)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2LCG)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2LCG)

(-) Gene Ontology  (1, 1)

NMR Structure(hide GO term definitions)
Chain A   (Q1LD49_CUPMC | Q1LD49)
biological process
    GO:0006950    response to stress    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a disturbance in organismal or cellular homeostasis, usually, but not necessarily, exogenous (e.g. temperature, humidity, ionizing radiation).

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2lcg)
 
  Sites
(no "Sites" information available for 2lcg)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2lcg)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2lcg
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q1LD49_CUPMC | Q1LD49
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q1LD49_CUPMC | Q1LD49
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q1LD49_CUPMC | Q1LD492n4a 2n4b

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2LCG)