2KZ7 - JenaLib

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Title :   SOLUTION STRUCTURE OF THE CARMIL CAH3A/B DOMAIN BOUND TO CAPPING PROTEIN (CP)

Authors :   A. Zwolak, N. Tjandra

Date :   12 Jun 10 (Deposition) - 14 Jul 10 (Release) - 14 Jul 10 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A,B,C  (10x)
NMR Structure *: A,B,C  (1x)

Keywords :   Trosy, Paramagnetic Relaxation Enhancement, Protein-Protein Complex, Protein Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   A. Zwolak, T. Uruno, G. P. Piszczek, J. A. Hammer Iii, N. Tjandra
Solution Structure Of The Carmil Cah3A/B Domain Bound To Capping Protein (Cp)
To Be Published
PubMed: search

Molecule 1 - F-ACTIN-CAPPING PROTEIN SUBUNIT ALPHA-1
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET
	Expression System Strain	:	BL21
	Expression System Taxid	:	562
	Expression System Vector	:	PLASMID
	Gene	:	CAPZA1
	Organism Common	:	BANTAM,CHICKENS
	Organism Scientific	:	GALLUS GALLUS
	Organism Taxid	:	9031
	Synonym	:	CAPZ 36/32, BETA-ACTININ SUBUNIT I

Molecule 2 - F-ACTIN-CAPPING PROTEIN SUBUNIT BETA ISOFORMS 1 AND 2
	Chains	:	B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET
	Expression System Strain	:	BL21
	Expression System Taxid	:	562
	Expression System Vector	:	PLASMID
	Gene	:	CAPZB
	Organism Common	:	BANTAM,CHICKENS
	Organism Scientific	:	GALLUS GALLUS
	Organism Taxid	:	9031
	Synonym	:	CAPZ B1 AND B2, CAPZ 36/32, BETA-ACTININ SUBUNIT II

Molecule 3 - LEUCINE-RICH REPEAT-CONTAINING PROTEIN 16A
	Chains	:	C
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PGEX4
	Expression System Strain	:	BL21
	Expression System Taxid	:	562
	Expression System Vector	:	PLASMID
	Gene	:	LRRC16A, CARMIL, LRRC16
	Organism Common	:	MOUSE
	Organism Scientific	:	MUS MUSCULUS
	Organism Taxid	:	10090
	Synonym	:	CARMIL HOMOLOG

		1	2	3
NMR Structure (10x)	:	A	B	C
NMR Structure * (1x)	:	A	B	C

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2KZ7)

(no "Site" information available for 2KZ7)

(no "SS Bond" information available for 2KZ7)

NMR Structure

No.	Model	Residues
1	1, 2, 3, 4, 5, 6, 7, 8, 9, 10	Pro A:183	-	Pro A:184
2	1, 2, 3, 4, 5, 6, 7, 8, 9, 10	Asp B:380	-	Pro B:381

NMR Structure (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_CAZA1_CHICK_001 *	F	163	I	CAZA1_CHICK	---	---	A	F	163	I
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

NMR Structure * (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_CAZA1_CHICK_001 *	F	163	I	CAZA1_CHICK	---	---	A	F	163	I
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

NMR Structure (3, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	F_ACTIN_CAPPING_BETA	PS00231	F-actin capping protein beta subunit signature.	CAPZB_CHICK	62-67	1	B:362-367
2	F_ACTIN_CAPPING_A_1	PS00748	F-actin capping protein alpha subunit signature 1.	CAZA1_CHICK	196-204	1	A:196-204
3	F_ACTIN_CAPPING_A_2	PS00749	F-actin capping protein alpha subunit signature 2.	CAZA1_CHICK	256-266	1	A:256-266

NMR Structure * (3, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	F_ACTIN_CAPPING_BETA	PS00231	F-actin capping protein beta subunit signature.	CAPZB_CHICK	62-67	1	B:362-367
2	F_ACTIN_CAPPING_A_1	PS00748	F-actin capping protein alpha subunit signature 1.	CAZA1_CHICK	196-204	1	A:196-204
3	F_ACTIN_CAPPING_A_2	PS00749	F-actin capping protein alpha subunit signature 2.	CAZA1_CHICK	256-266	1	A:256-266

NMR Structure (10, 10)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.2a	ENSGALT00000006425	2a	ENSGALE00000042043	chr21:4747591-4747501	91	CAPZB_CHICK	1-30	30	1	B:302-330	29
1.3	ENSGALT00000006425	3	ENSGALE00000042051	chr21:4734482-4734361	122	CAPZB_CHICK	31-71	41	1	B:331-371	41
1.4	ENSGALT00000006425	4	ENSGALE00000042045	chr21:4723866-4723753	114	CAPZB_CHICK	71-109	39	1	B:371-409	39
1.5	ENSGALT00000006425	5	ENSGALE00000042044	chr21:4709816-4709675	142	CAPZB_CHICK	109-156	48	1	B:409-456	48
1.6	ENSGALT00000006425	6	ENSGALE00000042049	chr21:4709146-4709030	117	CAPZB_CHICK	157-195	39	1	B:457-495	39
1.7	ENSGALT00000006425	7	ENSGALE00000042042	chr21:4702101-4702036	66	CAPZB_CHICK	196-217	22	1	B:496-517	22
1.8	ENSGALT00000006425	8	ENSGALE00000042048	chr21:4701227-4701151	77	CAPZB_CHICK	218-243	26	1	B:518-543	26
1.9	ENSGALT00000006425	9	ENSGALE00000042047	chr21:4699862-4699750	113	CAPZB_CHICK	243-276	34	1	B:543-571	29
1.10a	ENSGALT00000006425	10a	ENSGALE00000042050	chr21:4697971-4697725	247	CAPZB_CHICK	-	0	0	-	-

2.1a	ENSMUST00000072889	1a	ENSMUSE00000912403	chr13:24372664-24372430	235	CARL1_MOUSE	1-14	14	0	-	-
2.3	ENSMUST00000072889	3	ENSMUSE00000413275	chr13:24368423-24368326	98	CARL1_MOUSE	14-46	33	0	-	-
2.6	ENSMUST00000072889	6	ENSMUSE00000370559	chr13:24270126-24270076	51	CARL1_MOUSE	47-63	17	0	-	-
2.7b	ENSMUST00000072889	7b	ENSMUSE00000413785	chr13:24265544-24265485	60	CARL1_MOUSE	64-83	20	0	-	-
2.8b	ENSMUST00000072889	8b	ENSMUSE00000337149	chr13:24256791-24256670	122	CARL1_MOUSE	84-124	41	0	-	-
2.9b	ENSMUST00000072889	9b	ENSMUSE00000380434	chr13:24247356-24247259	98	CARL1_MOUSE	124-157	34	0	-	-
2.11	ENSMUST00000072889	11	ENSMUSE00000399014	chr13:24246923-24246853	71	CARL1_MOUSE	157-180	24	0	-	-
2.12	ENSMUST00000072889	12	ENSMUSE00000355440	chr13:24246620-24246547	74	CARL1_MOUSE	181-205	25	0	-	-
2.13	ENSMUST00000072889	13	ENSMUSE00000571498	chr13:24233600-24233525	76	CARL1_MOUSE	205-230	26	0	-	-
2.14a	ENSMUST00000072889	14a	ENSMUSE00000571497	chr13:24231246-24231158	89	CARL1_MOUSE	231-260	30	0	-	-
2.15	ENSMUST00000072889	15	ENSMUSE00000571496	chr13:24229100-24229006	95	CARL1_MOUSE	260-292	33	0	-	-
2.16	ENSMUST00000072889	16	ENSMUSE00000571495	chr13:24213794-24213708	87	CARL1_MOUSE	292-321	30	0	-	-
2.17	ENSMUST00000072889	17	ENSMUSE00000571494	chr13:24207447-24207344	104	CARL1_MOUSE	321-355	35	0	-	-
2.19	ENSMUST00000072889	19	ENSMUSE00000571493	chr13:24203960-24203883	78	CARL1_MOUSE	356-381	26	0	-	-
2.20	ENSMUST00000072889	20	ENSMUSE00000571492	chr13:24203755-24203679	77	CARL1_MOUSE	382-407	26	0	-	-
2.21b	ENSMUST00000072889	21b	ENSMUSE00000862598	chr13:24200463-24200359	105	CARL1_MOUSE	407-442	36	0	-	-
2.22	ENSMUST00000072889	22	ENSMUSE00000617391	chr13:24198247-24198178	70	CARL1_MOUSE	442-465	24	0	-	-
2.23	ENSMUST00000072889	23	ENSMUSE00000683869	chr13:24193952-24193941	12	CARL1_MOUSE	466-469	4	0	-	-
2.26a	ENSMUST00000072889	26a	ENSMUSE00000896395	chr13:24191532-24191451	82	CARL1_MOUSE	470-497	28	0	-	-
2.27	ENSMUST00000072889	27	ENSMUSE00000617388	chr13:24190929-24190830	100	CARL1_MOUSE	497-530	34	0	-	-
2.28	ENSMUST00000072889	28	ENSMUSE00000643068	chr13:24190729-24190675	55	CARL1_MOUSE	530-548	19	0	-	-
2.29a	ENSMUST00000072889	29a	ENSMUSE00000643067	chr13:24186439-24186267	173	CARL1_MOUSE	549-606	58	0	-	-
2.30	ENSMUST00000072889	30	ENSMUSE00000643065	chr13:24184443-24184375	69	CARL1_MOUSE	606-629	24	0	-	-
2.31	ENSMUST00000072889	31	ENSMUSE00000643062	chr13:24180940-24180847	94	CARL1_MOUSE	629-660	32	0	-	-
2.32	ENSMUST00000072889	32	ENSMUSE00000643060	chr13:24173896-24173798	99	CARL1_MOUSE	661-693	33	0	-	-
2.33	ENSMUST00000072889	33	ENSMUSE00000643058	chr13:24167609-24167481	129	CARL1_MOUSE	694-736	43	0	-	-
2.34	ENSMUST00000072889	34	ENSMUSE00000643057	chr13:24165940-24165809	132	CARL1_MOUSE	737-780	44	0	-	-
2.35	ENSMUST00000072889	35	ENSMUSE00000643055	chr13:24161675-24161500	176	CARL1_MOUSE	781-839	59	0	-	-
2.36	ENSMUST00000072889	36	ENSMUSE00000643053	chr13:24159088-24159001	88	CARL1_MOUSE	839-868	30	0	-	-
2.37a	ENSMUST00000072889	37a	ENSMUSE00000643052	chr13:24156595-24156446	150	CARL1_MOUSE	869-918	50	0	-	-
2.40	ENSMUST00000072889	40	ENSMUSE00000643049	chr13:24136951-24136885	67	CARL1_MOUSE	919-941	23	0	-	-
2.41	ENSMUST00000072889	41	ENSMUSE00000643046	chr13:24136239-24136043	197	CARL1_MOUSE	941-1006	66	1	C:601-647	47
2.42	ENSMUST00000072889	42	ENSMUSE00000643045	chr13:24133654-24133542	113	CARL1_MOUSE	1007-1044	38	1	C:648-682 (gaps)	37
2.43b	ENSMUST00000072889	43b	ENSMUSE00000643044	chr13:24128477-24128054	424	CARL1_MOUSE	1044-1185	142	0	-	-
2.44	ENSMUST00000072889	44	ENSMUSE00000643043	chr13:24117804-24117723	82	CARL1_MOUSE	1186-1213	28	0	-	-
2.45	ENSMUST00000072889	45	ENSMUSE00000643042	chr13:24116404-24116192	213	CARL1_MOUSE	1213-1284	72	0	-	-
2.46a	ENSMUST00000072889	46a	ENSMUSE00000643041	chr13:24114505-24114365	141	CARL1_MOUSE	1284-1331	48	0	-	-
2.49c	ENSMUST00000072889	49c	ENSMUSE00000478715	chr13:24105329-24104528	802	CARL1_MOUSE	1331-1374	44	0	-	-

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:275
 aligned with CAZA1_CHICK | P13127 from UniProtKB/Swiss-Prot  Length:286

    Alignment length:275
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276     
         CAZA1_CHICK      7 RVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMDQFTPVKIEGYDDQVLITEHGDLGNGRFLDPRNKISFKFDHLRKEASDPQPEDTESALKQWRDACDSALRAYVKDHYPNGFCTVYGKSIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFTITPPTAQVAAVLKIQVHYYEDGNVQLVSHKDIQDSVQVSSDVQTAKEFIKIIENAENEYQTAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGK  281
               SCOP domains d2kz7a_ A: Capz alpha-1 subunit                                                                                                                                                                                                                                                     SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -----F-actin_cap_A-2kz7A01 A:12-281                                                                                                                                                                                                                                                 Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eee........eee.........eee.....eeee...........ee......hhhhhhhhhhhhhhhhhhhh..eeeeeeeeee..eeeeeeeeeeeeeehhh.eeeeeeeeeeee....eeeeeeeeeeeeee...eeeeeeeeeeeeeeee...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhh...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------I---------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------F_ACTIN_C---------------------------------------------------F_ACTIN_CAP--------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2kz7 A    7 RVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMDQFTPVKIEGYDDQVLITEHGDLGNGRFLDPRNKISFKFDHLRKEASDPQPEDTESALKQWRDACDSALRAYVKDHYPNGFCTVYGKSIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFTITPPTAQVAAVLKIQVHYYEDGNVQLVSHKDIQDSVQVSSDVQTAKEFIKIIENAENEYQTAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGK  281
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276

Chain B from PDB  Type:PROTEIN  Length:270
 aligned with CAPZB_CHICK | P14315 from UniProtKB/Swiss-Prot  Length:277

    Alignment length:270
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271
         CAPZB_CHICK      2 SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSIDAIPDNQKYKQLQRELSQVLTQRQI  271
               SCOP domains d2kz7b_ B: Capz beta-1 subunit                                                                                                                                                                                                                                                 SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ---F_actin_cap_B-2kz7B01 B:305-540                                                                                                                                                                                                             ------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhh..hhhhhhhhhhhhhhhh..hhhhhhhhh....eeeee....eeeeehhh.ee..eee......ee.........hhhhhhhhhhhhhhhhhhhhhhhh..eeeeeeee...eeeeeeeeeee......eeeeeeeeeeeeeee.....eeeeeeeeeeeeeeeeeehhheeeeeeeeeeeeeeeeee.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------F_ACTI------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.2a  PDB: B:302-330    Exon 1.3  PDB: B:331-371 UniProt: 31-71  -------------------------------------Exon 1.5  PDB: B:409-456 UniProt: 109-156       Exon 1.6  PDB: B:457-495               Exon 1.7              Exon 1.8  PDB: B:518-543  ---------------------------- Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------------Exon 1.4  PDB: B:371-409               -------------------------------------------------------------------------------------------------------------------------------------Exon 1.9  PDB: B:543-571      Transcript 1 (2)
                2kz7 B  302 SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSIDAIPDNQKYKQLQRELSQVLTQRQI  571
                                   311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571

Chain C from PDB  Type:PROTEIN  Length:82
 aligned with CARL1_MOUSE | Q6EDY6 from UniProtKB/Swiss-Prot  Length:1374

    Alignment length:84
                                   969       979       989       999      1009      1019      1029      1039    
         CARL1_MOUSE    960 PPFPSVRQEKRSSGLISELPSEEGRRLEHFTKLRPKRNKKQQPTQAAVCTISILPQDGEQNGLMGRVDEGVDEFFTKKVTKMDC 1043
               SCOP domains ------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ................................................................................--.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------ PROSITE
               Transcript 2 Exon 2.41  PDB: C:601-647 UniProt: 941-1006    Exon 2.42  PDB: C:648-682 (gaps)      Transcript 2
                2kz7 C  601 GSWGCVRQEKRSSGLISELPSEEGRRLEHFTKLRPKRNKKQQPTQAAVCTISILPQDGEQNGLMGRVDEGVDEFFTKKVT--GC  682
                                   610       620       630       640       650       660       670       680  | 
                                                                                                         680  | 
                                                                                                            681

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "CATH Domain" information available for 2KZ7)

NMR Structure(hide GO term definitions)

Chain A (CAZA1_CHICK | P13127)

molecular function
	GO:0003779	actin binding	Interacting selectively and non-covalently with monomeric or multimeric forms of actin, including actin filaments.
biological process
	GO:0051693	actin filament capping	The binding of a protein or protein complex to the end of an actin filament, thus preventing the addition, exchange or removal of further actin subunits.
	GO:0051016	barbed-end actin filament capping	The binding of a protein or protein complex to the barbed (or plus) end of an actin filament, thus preventing the addition, exchange or removal of further actin subunits.
cellular component
	GO:0008290	F-actin capping protein complex	A heterodimer consisting of alpha and beta subunits that binds to and caps the barbed ends of actin filaments, thereby regulating the polymerization of actin monomers but not severing actin filaments.
	GO:0071203	WASH complex	A protein complex that localizes at the surface of endosomes, where it recruits and activates the Arp2/3 complex to induce actin polymerization. In human, the WASH complex is composed of F-actin-capping protein subunits alpha and beta, WASH1, FAM21, KIAA1033, KIAA0196 and CCDC53.
	GO:0030018	Z disc	Platelike region of a muscle sarcomere to which the plus ends of actin filaments are attached.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.

Chain B (CAPZB_CHICK | P14315)

molecular function
	GO:0003779	actin binding	Interacting selectively and non-covalently with monomeric or multimeric forms of actin, including actin filaments.
	GO:0051015	actin filament binding	Interacting selectively and non-covalently with an actin filament, also known as F-actin, a helical filamentous polymer of globular G-actin subunits.
	GO:0048487	beta-tubulin binding	Interacting selectively and non-covalently with the microtubule constituent protein beta-tubulin.
biological process
	GO:0030036	actin cytoskeleton organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of cytoskeletal structures comprising actin filaments and their associated proteins.
	GO:0051693	actin filament capping	The binding of a protein or protein complex to the end of an actin filament, thus preventing the addition, exchange or removal of further actin subunits.
	GO:0051016	barbed-end actin filament capping	The binding of a protein or protein complex to the barbed (or plus) end of an actin filament, thus preventing the addition, exchange or removal of further actin subunits.
	GO:0000902	cell morphogenesis	The developmental process in which the size or shape of a cell is generated and organized.
	GO:0030030	cell projection organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of a prolongation or process extending from a cell, e.g. a flagellum or axon.
	GO:0007010	cytoskeleton organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of cytoskeletal structures.
	GO:0030032	lamellipodium assembly	Formation of a lamellipodium, a thin sheetlike extension of the surface of a migrating cell.
	GO:0048747	muscle fiber development	The process whose specific outcome is the progression of the muscle fiber over time, from its formation to the mature structure. In skeletal muscle, fibers are formed by the maturation of myotubes. They can be classed as slow, intermediate/fast or fast.
	GO:0051490	negative regulation of filopodium assembly	Any process that stops, prevents, or reduces the frequency, rate or extent of the assembly of a filopodium, a thin, stiff protrusion extended by the leading edge of a motile cell such as a crawling fibroblast or amoeba, or an axonal growth cone.
	GO:0031115	negative regulation of microtubule polymerization	Any process that stops, prevents, or reduces the frequency, rate or extent of microtubule polymerization.
	GO:0031175	neuron projection development	The process whose specific outcome is the progression of a neuron projection over time, from its formation to the mature structure. A neuron projection is any process extending from a neural cell, such as axons or dendrites (collectively called neurites).
	GO:0022604	regulation of cell morphogenesis	Any process that modulates the frequency, rate or extent of cell morphogenesis. Cell morphogenesis is the developmental process in which the shape of a cell is generated and organized.
	GO:0010591	regulation of lamellipodium assembly	Any process that modulates the rate, frequency or extent of the formation of a lamellipodium, a thin sheetlike extension of the surface of a migrating cell.
	GO:0090036	regulation of protein kinase C signaling	Any process that modulates the frequency, rate, or extent of a series of reactions, mediated by the intracellular serine/threonine kinase protein kinase C, which occurs as a result of a single trigger reaction or compound.
cellular component
	GO:0008290	F-actin capping protein complex	A heterodimer consisting of alpha and beta subunits that binds to and caps the barbed ends of actin filaments, thereby regulating the polymerization of actin monomers but not severing actin filaments.
	GO:0031674	I band	A region of a sarcomere that appears as a light band on each side of the Z disc, comprising a region of the sarcomere where thin (actin) filaments are not overlapped by thick (myosin) filaments; contains actin, troponin, and tropomyosin; each sarcomere includes half of an I band at each end.
	GO:0030018	Z disc	Platelike region of a muscle sarcomere to which the plus ends of actin filaments are attached.
	GO:0001669	acrosomal vesicle	A structure in the head of a spermatozoon that contains acid hydrolases, and is concerned with the breakdown of the outer membrane of the ovum during fertilization. It lies just beneath the plasma membrane and is derived from the lysosome.
	GO:0005884	actin filament	A filamentous structure formed of a two-stranded helical polymer of the protein actin and associated proteins. Actin filaments are a major component of the contractile apparatus of skeletal muscle and the microfilaments of the cytoskeleton of eukaryotic cells. The filaments, comprising polymerized globular actin molecules, appear as flexible structures with a diameter of 5-9 nm. They are organized into a variety of linear bundles, two-dimensional networks, and three dimensional gels. In the cytoskeleton they are most highly concentrated in the cortex of the cell just beneath the plasma membrane.
	GO:0005903	brush border	The dense covering of microvilli on the apical surface of a epithelial cells in tissues such as the intestine, kidney, and choroid plexus; the microvilli aid absorption by increasing the surface area of the cell.
	GO:0030863	cortical cytoskeleton	The portion of the cytoskeleton that lies just beneath the plasma membrane.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005856	cytoskeleton	Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0014704	intercalated disc	A complex cell-cell junction at which myofibrils terminate in cardiomyocytes; mediates mechanical and electrochemical integration between individual cardiomyocytes. The intercalated disc contains regions of tight mechanical attachment (fasciae adherentes and desmosomes) and electrical coupling (gap junctions) between adjacent cells.
	GO:0030027	lamellipodium	A thin sheetlike process extended by the leading edge of a migrating cell or extending cell process; contains a dense meshwork of actin filaments.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

Chain C (CARL1_MOUSE | Q6EDY6)

molecular function
	GO:0032403	protein complex binding	Interacting selectively and non-covalently with any protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0051639	actin filament network formation	The assembly of a network of actin filaments; actin filaments on different axes and with differing orientations are crosslinked together to form a mesh of filaments.
	GO:0051638	barbed-end actin filament uncapping	The removal of capping protein from the barbed (or plus) end of actin filaments to free the ends for addition, exchange or removal of further actin subunits.
	GO:0016477	cell migration	The controlled self-propelled movement of a cell from one site to a destination guided by molecular cues. Cell migration is a central process in the development and maintenance of multicellular organisms.
	GO:0007163	establishment or maintenance of cell polarity	Any cellular process that results in the specification, formation or maintenance of anisotropic intracellular organization or cell growth patterns.
	GO:0030032	lamellipodium assembly	Formation of a lamellipodium, a thin sheetlike extension of the surface of a migrating cell.
	GO:0044351	macropinocytosis	An endocytosis process that results in the uptake of liquid material by cells from their external environment by the 'ruffling' of the cell membrane to form heterogeneously sized intracellular vesicles called macropinosomes, which can be up to 5 micrometers in size.
	GO:2000813	negative regulation of barbed-end actin filament capping	Any process that stops, prevents or reduces the frequency, rate or extent of barbed-end actin filament capping.
	GO:0030838	positive regulation of actin filament polymerization	Any process that activates or increases the frequency, rate or extent of actin polymerization.
	GO:0030335	positive regulation of cell migration	Any process that activates or increases the frequency, rate or extent of cell migration.
	GO:1902745	positive regulation of lamellipodium organization	Any process that activates or increases the frequency, rate or extent of lamellipodium organization.
	GO:0051496	positive regulation of stress fiber assembly	Any process that activates or increases the frequency, rate or extent of the assembly of a stress fiber, a bundle of microfilaments and other proteins found in fibroblasts.
	GO:1900026	positive regulation of substrate adhesion-dependent cell spreading	Any process that activates or increases the frequency, rate or extent of substrate adhesion-dependent cell spreading.
	GO:0031529	ruffle organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of a ruffle, a projection at the leading edge of a crawling cell.
	GO:0046415	urate metabolic process	The chemical reactions and pathways involving urate, the anion of uric acid, 2,6,8-trioxypurine, the end product of purine metabolism in certain mammals and the main excretory product in uricotelic animals.
cellular component
	GO:0031252	cell leading edge	The area of a motile cell closest to the direction of movement.
	GO:0042995	cell projection	A prolongation or process extending from a cell, e.g. a flagellum or axon.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005856	cytoskeleton	Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0031941	filamentous actin	A two-stranded helical polymer of the protein actin.
	GO:0045111	intermediate filament cytoskeleton	Cytoskeletal structure made from intermediate filaments, typically organized in the cytosol as an extended system that stretches from the nuclear envelope to the plasma membrane. Some intermediate filaments run parallel to the cell surface, while others traverse the cytosol; together they form an internal framework that helps support the shape and resilience of the cell.
	GO:0030027	lamellipodium	A thin sheetlike process extended by the leading edge of a migrating cell or extending cell process; contains a dense meshwork of actin filaments.
	GO:0044354	macropinosome	A membrane-bounded, uncoated intracellular vesicle formed by the process of macropinocytosis.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2kz7)

	Sites
(no "Sites" information available for 2kz7)

	Cis Peptide Bonds
		Asp B:380 - Pro B:381	[ RasMol ]
		Pro A:183 - Pro A:184	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2kz7
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CAPZB_CHICK \| P14315
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	CARL1_MOUSE \| Q6EDY6
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	CAZA1_CHICK \| P13127
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CAPZB_CHICK \| P14315
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	CARL1_MOUSE \| Q6EDY6
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	CAZA1_CHICK \| P13127
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	CAPZB_CHICK \| P14315	:	1izn 2kxp 3aa0 3aa1 3aa6 3aa7 3aaa 3aae 3lk2 3lk3 3lk4
	CARL1_MOUSE \| Q6EDY6	:	3aa0 3aae 4k17
	CAZA1_CHICK \| P13127	:	1izn 2kxp 3aa0 3aa1 3aa6 3aa7 3aaa 3aae 3lk2 3lk3 3lk4

2kxp	SOLUTION NMR STRUCTURE OF V-1 BOUND TO CAPPING PROTEIN (CP)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (2, 20)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 1)

PROSITE Motifs (3, 3)

Exons (10, 10)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 2)

CATH Domains (0, 0)

Pfam Domains (2, 2)

Gene Ontology (53, 66)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File