Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  MINIMAL CONSTRAINT SOLUTION NMR STRUCTURE OF TRANSLATIONALLY-CONTROLLED TUMOR PROTEIN (TCTP) FROM C.ELEGANS, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET WR73
 
Authors :  J. M. Aramini, P. Rossi, J. R. Cort, B. Cooper, M. Maglaqui, H. Janjua, R. T. B. Acton, J. K. Everett, G. T. Montelione, Northeast Structural G Consortium (Nesg)
Date :  02 Apr 10  (Deposition) - 28 Apr 10  (Release) - 28 Apr 10  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Structural Genomics, Northeast Structural Genomics Consortium (Nesg), Psi-2, Protein Structure Initiative, Metal Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. M. Aramini, P. Rossi, J. R. Cort, B. Cooper, M. Maglaqui, H. Janjua, R. Xiao, T. B. Acton, J. K. Everett, G. T. Montelione
Minimal Constraint Solution Nmr Structure Of Translationally-Controlled Tumor Protein (Tctp) From C. Elegans, Northeast Structural Genomics Consortium Target Wr73
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - TRANSLATIONALLY-CONTROLLED TUMOR PROTEIN HOMOLOG
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: BL21(DE3)PMGK
    Expression System Taxid: 469008
    Expression System Vector: PET21
    Gene: F25H2.11, TCT-1
    Organism Common: NEMATODE
    Organism Scientific: CAENORHABDITIS ELEGANS
    Organism Taxid: 6239
    Synonym: TCTP

 Structural Features

(-) Chains, Units

  
NMR Structure (20x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2KWB)

(-) Sites  (0, 0)

(no "Site" information available for 2KWB)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2KWB)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2KWB)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2KWB)

(-) PROSITE Motifs  (3, 3)

NMR Structure (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1TCTP_3PS51797 Translationally controlled tumor protein (TCTP) domain profile.TCTP_CAEEL1-181  1A:1-181
2TCTP_1PS01002 Translationally controlled tumor protein (TCTP) domain signature 1.TCTP_CAEEL45-55  1A:45-55
3TCTP_2PS01003 Translationally controlled tumor protein (TCTP) domain signature 2.TCTP_CAEEL133-158  1A:133-158

(-) Exons   (0, 0)

(no "Exon" information available for 2KWB)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:183
 aligned with TCTP_CAEEL | Q93573 from UniProtKB/Swiss-Prot  Length:181

    Alignment length:183
                                                                                                                                                                                                              181  
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180|  
           TCTP_CAEEL     1 MLIYKDIFTDDELSSDSFPMKLVDDLVYEFKGKHVVRKEGEIVLAGSNPSAEEGAEDDGSDEHVERGIDIVLNHKLVEMNCYEDASMFKAYIKKFMKNVIDHMEKNNRDKADVDAFKKKIQGWVVSLLAKDRFKNLAFFIGERAAEGAENGQVAIIEYRDVDGTEVPTLMLVKEAIIEEKC--   -
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains TCTP-2kwbA01 A:1-178                                                                                                                                                              ----- Pfam domains
         Sec.struct. author .eeeee.......eee....eee...eeeee..ee........................hhhhh..eehhhhh..eeeehhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeehhhhhhh....eeeeeeeee..eeeeeeeee...eeee.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) TCTP_3  PDB: A:1-181 UniProt: 1-181                                                                                                                                                  -- PROSITE (1)
                PROSITE (2) --------------------------------------------TCTP_1     -----------------------------------------------------------------------------TCTP_2  PDB: A:133-158    ------------------------- PROSITE (2)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2kwb A   1 MLIYKDIFTDDELSSDSFPMKLVDDLVYEFKGKHVVRKEGEIVLAGSNPSAEEGAEDDGSDEHVERGIDIVLNHKLVEMNCYEDASMFKAYIKKFMKNVIDHMEKNNRDKADVDAFKKKIQGWVVSLLAKDRFKNLAFFIGERAAEGAENGQVAIIEYRDVDGTEVPTLMLVKEAIIEEKCLE 183
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2KWB)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2KWB)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: Mss4-like (8)

(-) Gene Ontology  (2, 2)

NMR Structure(hide GO term definitions)
Chain A   (TCTP_CAEEL | Q93573)
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005783    endoplasmic reticulum    The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2kwb)
 
  Sites
(no "Sites" information available for 2kwb)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2kwb)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2kwb
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  TCTP_CAEEL | Q93573
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  TCTP_CAEEL | Q93573
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        TCTP_CAEEL | Q93573: 2loy

(-) Related Entries Specified in the PDB File

wr73