Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION NMR STRUCTURE OF THE N-TERMINAL DOMAIN OF PROTEIN PG_0361 FROM P.GINGIVALIS, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET PGR37A
 
Authors :  A. Eletsky, J. L. Mills, D. Lee, C. Ciccosanti, K. Hamilton, T. B. Acton, J. K. Everett, G. T. Montelione, T. Szyperski, Northeast Structural Consortium (Nesg)
Date :  31 Mar 10  (Deposition) - 28 Apr 10  (Release) - 28 Apr 10  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Structural Genomics, Northeast Structural Genomics Consortium (Nesg), Psi-2, Protein Structure Initiative, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. Eletsky, J. L. Mills, D. Lee, C. Ciccosanti, K. Hamilton, T. B. Acton, R. Xiao, J. K. Everett, G. T. Montelione, T. Szyperski
Solution Nmr Structure Of The N-Terminal Domain Of Protein Pg_0361 From P. Gingivalis, Northeast Structural Genomics Consortium Target Target Pgr37A
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - CONSERVED DOMAIN PROTEIN
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: BL21(DE3)+ MAGIC
    Expression System Taxid: 469008
    Expression System Vector: PET 21-23C
    Fragment: SEQUENCE DATABASE RESIDUES 35-182
    Gene: PG_0361
    Organism Scientific: PORPHYROMONAS GINGIVALIS
    Organism Taxid: 837
    Strain: W83

 Structural Features

(-) Chains, Units

  
NMR Structure (20x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2KW7)

(-) Sites  (0, 0)

(no "Site" information available for 2KW7)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2KW7)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2KW7)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2KW7)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2KW7)

(-) Exons   (0, 0)

(no "Exon" information available for 2KW7)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:157
 aligned with Q7MX54_PORGI | Q7MX54 from UniProtKB/TrEMBL  Length:435

    Alignment length:257
                                    43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       
         Q7MX54_PORGI    34 QRVYKPEDVPNVQLADSTRLVTDEAGLLSNAQEEVMNGRLRAIRSSHAVEFAVVTLPSIGDAPLEDFTLKLARQWGVGNEKNNNGLLLVLVLDQRRVRFETGYGLEGYLPDGLLSRIIHDRMIPHFRSGNYAEGLSEGVLAVQQVLDGSYDVKPDGGDRSAVSRVSWGTIFIFYCFFMLLASASVLYQLTSYRRQYPRATAVEEYEFLRRRISMLGCVFLLLFPPGFIVVMAIIKSRQNKLKKEMAVCPCCHQHSVH 290
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------Repair_PSII-2kw7A01 A:27-146                                                                                            --------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhh.hhhhh.....eee.....hhhhhhhhhhhhhhhhhh...eeeeeee......hhhhhhhhhhhhhh........eeeeeee....eeeeee........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.----------------------------------------------------------------------------------------------------...... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2kw7 A   1 MRVYKPEDVPNVQLADSTRLVTDEAGLLSNAQEEVMNGRLRAIRSSHAVEFAVVTLPSIGDAPLEDFTLKLARQWGVGNEKNNNGLLLVLVLDQRRVRFETGYGLEGYLPDGLLSRIIHDRMIPHFRSGNYAEGLSEGVLAVQQVLDGSLE----------------------------------------------------------------------------------------------------HHHHHH 157
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150|        -         -         -         -         -         -         -         -         -         - |     
                                                                                                                                                                                151                                                                                                  152
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2KW7)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2KW7)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: no clan defined [family: Repair_PSII] (1)

(-) Gene Ontology  (2, 2)

NMR Structure(hide GO term definitions)
Chain A   (Q7MX54_PORGI | Q7MX54)
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2kw7)
 
  Sites
(no "Sites" information available for 2kw7)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2kw7)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2kw7
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q7MX54_PORGI | Q7MX54
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q7MX54_PORGI | Q7MX54
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2KW7)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2KW7)