|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2KQ2) |
Sites (0, 0)| (no "Site" information available for 2KQ2) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2KQ2) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2KQ2) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2KQ2) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2KQ2) |
Exons (0, 0)| (no "Exon" information available for 2KQ2) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:147 aligned with B8FYP4_DESHD | B8FYP4 from UniProtKB/TrEMBL Length:206 Alignment length:147 206 77 87 97 107 117 127 137 147 157 167 177 187 197 |- B8FYP4_DESHD 68 RDDRTEYDVYTDGSYVNGQYAWAYAFVKDGKVHYEDADVGKNPAAATMRNVAGEIAAALYAVKKASQLGVKIRILHDYAGIAFWATGEWKAKNEFTQAYAKLMNQYRGIYSFEKVKAHSGNEFNDYVDMKAKSALGIRD-------- - SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ---RNase_H-2kq2A01 A:4-136 ----------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 2kq2 A 1 MDDRTEYDVYTDGSYVNGQYAWAYAFVKDGKVHYEDADVGKNPAAATMRNVAGEIAAALYAVKKASQLGVKIRILHDYAGIAFWATGEWKAKNEFTQAYAKLMNQYRGIYSFEKVKAHSGNEFNDYVDMKAKSALGIRDLEHHHHHH 147 10 20 30 40 50 60 70 80 90 100 110 120 130 140
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2KQ2) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2KQ2) |
Pfam Domains (1, 1)
NMR Structure
|
Gene Ontology (3, 3)|
NMR Structure(hide GO term definitions) Chain A (B8FYP4_DESHD | B8FYP4)
|
||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|