|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
NMR Structure (1, 1)
|
Sites (1, 1)
NMR Structure (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2KOP) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2KOP) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2KOP) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2KOP) |
Exons (0, 0)| (no "Exon" information available for 2KOP) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:81 aligned with P72393_STRCH | P72393 from UniProtKB/TrEMBL Length:82 Alignment length:81 11 21 31 41 51 61 71 81 P72393_STRCH 2 AATQEEIVAGLAEIVNEIAGIPVEDVKLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIPDDDVKNLKTVGDATKYILDHQA 82 SCOP domains d2kopa_ A: automated matches SCOP domains CATH domains --------------------------------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------- Transcript 2kop A 1 AATQEEIVAGLAEIVNEIAGIPVEDVKLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIPDDDVKNLKTVGDATKYILDHQA 81 10 20 30 40 50 60 70 80
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 2KOP) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2KOP) |
Gene Ontology (5, 5)|
NMR Structure(hide GO term definitions) Chain A (P72393_STRCH | P72393)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|