|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2KL7) |
Sites (0, 0)| (no "Site" information available for 2KL7) |
SS Bonds (3, 3)
NMR Structure
|
||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2KL7) |
SAPs(SNPs)/Variants (1, 1)
NMR Structure (1, 1)
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||
PROSITE Motifs (2, 2)
NMR Structure (2, 2)
|
||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2KL7) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:71 aligned with FBLN4_HUMAN | O95967 from UniProtKB/Swiss-Prot Length:443 Alignment length:71 62 72 82 92 102 112 122 FBLN4_HUMAN 53 RDVNECLTIPEACKGEMKCINHYGGYLCLPRSAAVINDLHGEGPPPPVPPAQHPNPCPPGYEPDDQDSCVD 123 SCOP domains ----------------------------------------------------------------------- SCOP domains CATH domains ----------------------------------------------------------------------- CATH domains Pfam domains -EGF_CA-2kl7A01 A:2-35 ------------------------------------ Pfam domains SAPs(SNPs) ----K------------------------------------------------------------------ SAPs(SNPs) PROSITE (1) -EGF_CA PDB: A:2-28 ------------------------------------------E PROSITE (1) PROSITE (2) ----------------------------------------------------------------------E PROSITE (2) Transcript ----------------------------------------------------------------------- Transcript 2kl7 A 1 SDVNECLTIPEACKGEMKCINHYGGYLCLPRSAAVINDLHGEGPPPPVPPAQHPNPCPPGYEPDDQDSCVD 71 10 20 30 40 50 60 70
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2KL7) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2KL7) |
Pfam Domains (1, 1)| NMR Structure |
Gene Ontology (7, 7)|
NMR Structure(hide GO term definitions) Chain A (FBLN4_HUMAN | O95967)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|