|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2KEP) |
Sites (0, 0)| (no "Site" information available for 2KEP) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2KEP) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2KEP) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2KEP) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2KEP) |
Exons (0, 0)| (no "Exon" information available for 2KEP) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:110 aligned with GSPG_PSEAE | Q00514 from UniProtKB/Swiss-Prot Length:142 Alignment length:110 42 52 62 72 82 92 102 112 122 132 142 GSPG_PSEAE 33 MSRPDQAKVTVAKGDIKAIAAALDMYKLDNFAYPSTQQGLEALVKKPTGNPQPKNWNKDGYLKKLPVDPWGNPYQYLAPGTKGPFDLYSLGADGKEGGSDNDADIGNWDN 142 SCOP domains d2kepa_ A: automated matches SCOP domains CATH domains -------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains T2SG-2kepA01 A:39-146 -- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------- Transcript 2kep A 39 MSRPDQAKVTVAKGDIKAIAAALDMYKLDNFAYPSTQQGLEALVKKPTGNPQPKNWNKDGYLKKLPVDPWGNPYQYLAPGTKGPFDLYSLGADGKEGGSDNDADIGNWDN 148 48 58 68 78 88 98 108 118 128 138 148
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 2KEP) |
Pfam Domains (1, 1)| NMR Structure |
Gene Ontology (5, 5)|
NMR Structure(hide GO term definitions) Chain A (GSPG_PSEAE | Q00514)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|