|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 2KEL) |
(no "Site" information available for 2KEL) |
(no "SS Bond" information available for 2KEL) |
(no "Cis Peptide Bond" information available for 2KEL) |
(no "SAP(SNP)/Variant" information available for 2KEL) |
(no "PROSITE Motif" information available for 2KEL) |
(no "Exon" information available for 2KEL) |
NMR StructureChain A from PDB Type:PROTEIN Length:46 aligned with Y56B_SIRV1 | Q8QL46 from UniProtKB/Swiss-Prot Length:56 Alignment length:46 20 30 40 50 Y56B_SIRV1 11 KQKAVFGIYMDKDLKTRLKVYCAKNNLQLTQAIEEAIKEYLQKRNG 56 SCOP domains ---------------------------------------------- SCOP domains CATH domains ---------------------------------------------- CATH domains Pfam domains ---------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------- PROSITE Transcript ---------------------------------------------- Transcript 2kel A 11 KQKAVFGIYMDKDLKTRLKVYCAKNNLQLTQAIEEAIKEYLQKRNG 56 20 30 40 50 Chain B from PDB Type:PROTEIN Length:46 aligned with Y56B_SIRV1 | Q8QL46 from UniProtKB/Swiss-Prot Length:56 Alignment length:46 20 30 40 50 Y56B_SIRV1 11 KQKAVFGIYMDKDLKTRLKVYCAKNNLQLTQAIEEAIKEYLQKRNG 56 SCOP domains ---------------------------------------------- SCOP domains CATH domains ---------------------------------------------- CATH domains Pfam domains (1) RepB-RCR_reg-2kelB01 B:11-56 Pfam domains (1) Pfam domains (2) RepB-RCR_reg-2kelB02 B:11-56 Pfam domains (2) SAPs(SNPs) ---------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------- PROSITE Transcript ---------------------------------------------- Transcript 2kel B 11 KQKAVFGIYMDKDLKTRLKVYCAKNNLQLTQAIEEAIKEYLQKRNG 56 20 30 40 50
|
(no "SCOP Domain" information available for 2KEL) |
(no "CATH Domain" information available for 2KEL) |
NMR Structure
|
NMR Structure(hide GO term definitions) Chain A,B (Y56B_SIRV1 | Q8QL46)
|
|
|
|
|
|
|