|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
NMR Structure (1, 1)
|
Sites (1, 1)
NMR Structure (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2KDX) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2KDX) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2KDX) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2KDX) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:119 aligned with HYPA_HELPY | P0A0U4 from UniProtKB/Swiss-Prot Length:117 Alignment length:119 1 | 8 18 28 38 48 58 68 78 88 98 108 HYPA_HELPY - --MHEYSVVSSLIALCEEHAKKNQAHKIERVVVGIGERSAMDKSLFVSAFETFREESLVCKDAILDIVDEKVELECKDCSHVFKPNALDYGVCEKCHSKNVIITQGNEMRLLSLEMLAE 117 SCOP domains ----------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains ----------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains --HypA-2kdxA01 A:3-117 -- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -----------------------------------HYPA PDB: A:36-79 UniProt: 34-77 ---------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------- Transcript 2kdx A 1 GSMHEYSVVSSLIALCEEHAKKNQAHKIERVVVGIGERSAMDKSLFVSAFETFREESLVCKDAILDIVDEKVELECKDCSHVFKPNALDYGVCEKCHSKNVIITQGNEMRLLSLEMLAE 119 10 20 30 40 50 60 70 80 90 100 110
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2KDX) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2KDX) |
Pfam Domains (1, 1)
NMR Structure
|
Gene Ontology (3, 3)|
NMR Structure(hide GO term definitions) Chain A (HYPA_HELPY | P0A0U4)
|
||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|