|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2KA7) |
Sites (0, 0)| (no "Site" information available for 2KA7) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2KA7) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2KA7) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2KA7) |
PROSITE Motifs (2, 2)
NMR Structure (2, 2)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2KA7) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:124 aligned with GCSH_THEMA | Q9WY55 from UniProtKB/Swiss-Prot Length:124 Alignment length:124 10 20 30 40 50 60 70 80 90 100 110 120 GCSH_THEMA 1 MKMKKYTKTHEWVSIEDKVATVGITNHAQEQLGDVVYVDLPEVGREVKKGEVVASIESVKAAADVYAPLSGKIVEVNEKLDTEPELINKDPEGEGWLFKMEISDEGELEDLLDEQAYQEFCAQE 124 SCOP domains ---------------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains 2ka7A00 A:1-124 [code=2.40.50.100, no name defined] CATH domains Pfam domains ---GCV_H-2ka7A01 A:4-124 Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) ------------------BIOTINYL_LIPOYL PDB: A:19-101 UniProt: 19-101 ----------------------- PROSITE (1) PROSITE (2) -------------------------------------------LIPOYL PDB: A:44-73 --------------------------------------------------- PROSITE (2) Transcript ---------------------------------------------------------------------------------------------------------------------------- Transcript 2ka7 A 1 MKMKKYTKTHEWVSIEDKVATVGITNHAQEQLGDVVYVDLPEVGREVKKGEVVASIESVKAAADVYAPLSGKIVEVNEKLDTEPELINKDPEGEGWLFKMEISDEGELEDLLDEQAYQEFCAQE 124 10 20 30 40 50 60 70 80 90 100 110 120
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2KA7) |
CATH Domains (1, 1)
NMR Structure
|
Pfam Domains (1, 1)| NMR Structure |
Gene Ontology (2, 2)|
NMR Structure(hide GO term definitions) Chain A (GCSH_THEMA | Q9WY55)
|
||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|