|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2K8A) |
Sites (0, 0)| (no "Site" information available for 2K8A) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2K8A) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2K8A) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2K8A) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2K8A) |
Exons (0, 0)| (no "Exon" information available for 2K8A) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:80 aligned with PLAP_HUMAN | Q9Y263 from UniProtKB/Swiss-Prot Length:795 Alignment length:80 395 405 415 425 435 445 455 465 PLAP_HUMAN 386 ANQQTSGKVLYEGKEFDYVFSIDVNEGGPSYKLPYNTSDDPWLTAYNFLQKNDLNPMFLDQVAKFIIDNTKGQMLGLGNP 465 SCOP domains -------------------------------------------------------------------------------- SCOP domains CATH domains -------------------------------------------------------------------------------- CATH domains Pfam domains PFU-2k8aA01 A:49-124 ---- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------- Transcript 2k8a A 49 ANQQTSGKVLYEGKEFDYVFSIDVNEGGPSYKLPYNTSDDPWLTAYNFLQKNDLNPMFLDQVAKFIIDNTKGQMLGLGNP 128 58 68 78 88 98 108 118 128
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2K8A) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2K8A) |
Pfam Domains (1, 1)
NMR Structure
|
Gene Ontology (7, 7)|
NMR Structure(hide GO term definitions) Chain A (PLAP_HUMAN | Q9Y263)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|