Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - model 1, sites
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - model 1, sites
NMR Structure - model 1, sites  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF A TETRAHAEM CYTOCHROME FROM SHEWANELLA FRIGIDIMARINA
 
Authors :  V. B. Paixao, D. L. Turner, C. A. Salgueiro, L. Brennan, G. A. Reid, S. K. Chapman
Date :  19 May 08  (Deposition) - 31 Mar 09  (Release) - 31 Mar 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Multihaem Cytochromes, Redox Proteins, Nmr, Shewanella, Electron Transport, Heme, Iron, Metal-Binding, Periplasm, Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  V. B. Paixao, C. A. Salgueiro, L. Brennan, G. A. Reid, S. K. Chapman, D. L. Turner
The Solution Structure Of A Tetraheme Cytochrome From Shewanella Frigidimarina Reveals A Novel Family Structural Motif
Biochemistry V. 47 11973 2008
PubMed-ID: 18950243  |  Reference-DOI: 10.1021/BI801326J
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - TETRAHEME CYTOCHROME C-TYPE
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Expression System Vector: PJQ200KS
    Expression System Vector Type: VECTOR
    Gene: CCTA, SFRI_1504
    Organism Scientific: SHEWANELLA FRIGIDIMARINA
    Organism Taxid: 318167
    Strain: NCIMB 400
    Synonym: CYTOCHROME C3, SFC

 Structural Features

(-) Chains, Units

  
NMR Structure (20x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 4)

NMR Structure (1, 4)
No.NameCountTypeFull Name
1HEM4Ligand/IonPROTOPORPHYRIN IX CONTAINING FE

(-) Sites  (4, 4)

NMR Structure (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWARELEU A:5 , ALA A:6 , GLU A:7 , HIS A:9 , GLY A:14 , CYS A:15 , ASN A:17 , CYS A:18 , HIS A:19 , PRO A:24 , GLY A:28 , ALA A:29 , GLU A:31 , ALA A:59BINDING SITE FOR RESIDUE HEM A 218
2AC2SOFTWARELEU A:5 , PHE A:8 , HIS A:9 , MET A:12 , ASN A:17 , CYS A:18 , GLN A:34 , CYS A:35 , SER A:37 , CYS A:38 , HIS A:39 , ALA A:59 , LYS A:68BINDING SITE FOR RESIDUE HEM A 238
3AC3SOFTWAREPHE A:32 , CYS A:35 , GLN A:36 , HIS A:39 , LEU A:42 , MET A:45 , ASN A:48 , HIS A:49 , HIS A:52 , LEU A:56 , CYS A:61 , GLU A:71 , LYS A:72 , PRO A:73 , THR A:74BINDING SITE FOR RESIDUE HEM A 261
4AC4SOFTWAREASN A:48 , PRO A:51 , LEU A:56 , ASP A:60 , CYS A:61 , PRO A:73 , THR A:74 , CYS A:75 , THR A:77 , HIS A:79 , ARG A:83BINDING SITE FOR RESIDUE HEM A 278

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2K3V)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2K3V)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2K3V)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1MULTIHEME_CYTCPS51008 Multiheme cytochrome c family profile.CYC3_SHEFN35-109  1A:10-84

(-) Exons   (0, 0)

(no "Exon" information available for 2K3V)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:86
 aligned with CYC3_SHEFN | O33731 from UniProtKB/Swiss-Prot  Length:111

    Alignment length:86
                                    35        45        55        65        75        85        95       105      
           CYC3_SHEFN    26 ADETLAEFHVEMGGCENCHADGEPSKDGAYEFEQCQSCHGSLAEMDDNHKPHDGLLMCADCHAPHEAKVGEKPTCDTCHDDGRTAK 111
               SCOP domains d2k3va_ A: automated matches                                                           SCOP domains
               CATH domains 2k3vA00 A:1-86 Flavocytochrome C3; Chain A                                             CATH domains
               Pfam domains -------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhh.........hhhhhhhh.....hhhhh..hhhhhh...hhhhhh...........hhhhh........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------MULTIHEME_CYTC  PDB: A:10-84 UniProt: 35-109                               -- PROSITE
                 Transcript -------------------------------------------------------------------------------------- Transcript
                 2k3v A   1 ADETLAEFHVEMGGCENCHADGEPSKDGAYEFEQCQSCHGSLAEMDDNHKPHDGLLMCADCHAPHEAKVGEKPTCDTCHDDGRTAK  86
                                    10        20        30        40        50        60        70        80
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2K3V)

(-) Gene Ontology  (3, 3)

NMR Structure(hide GO term definitions)
Chain A   (CYC3_SHEFN | O33731)
molecular function
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
    GO:0042597    periplasmic space    The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria).

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    HEM  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2k3v)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - model 1, sites PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2k3v
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CYC3_SHEFN | O33731
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CYC3_SHEFN | O33731
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2K3V)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2K3V)