|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2JWH) |
Sites (0, 0)| (no "Site" information available for 2JWH) |
SS Bonds (2, 2)
NMR Structure
|
||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2JWH) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2JWH) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2JWH) |
Exons (0, 0)| (no "Exon" information available for 2JWH) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:48 aligned with VSI4_TRYBB | P26329 from UniProtKB/Swiss-Prot Length:514 Alignment length:56 445 455 465 475 485 VSI4_TRYBB 436 GEKNCQFNSTKASKSGVPVTQTQTAGADTTAEKCKGKGEKDCKSPDCKWEGGTCKD 491 SCOP domains -------------------------------------------------------- SCOP domains CATH domains -------------------------------------------------------- CATH domains Pfam domains ---------Trypan_glycop_C-2jwhA01 A:422-468 Pfam domains
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2JWH) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2JWH) |
Pfam Domains (1, 1)
NMR Structure
|
Gene Ontology (4, 4)|
NMR Structure(hide GO term definitions) Chain A (VSI4_TRYBB | P26329)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|