Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  NMR SOLUTION STRUCTURE OF HOMODIMER PROTEIN SO_2176 FROM SHEWANELLA ONEIDENSIS. NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET SOR77
 
Authors :  T. A. Ramelot, J. R. Cort, D. Wang, C. Nwosu, L. Owens, R. Xiao, J. Liu, M. C G. V. T. Swapna, T. B. Acton, B. Rost, G. T. Montelione, M. A. Kennedy, No Structural Genomics Consortium (Nesg)
Date :  03 Sep 07  (Deposition) - 18 Sep 07  (Release) - 13 Jul 11  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A,B  (20x)
NMR Structure *:  A,B  (1x)
Keywords :  Homodimer, Helix, Dimer, All Alpha, Northeast Structural Genomics Consortium, Nesg, Structural Genomics, Unknown Function, Psi-2, Protein Structure Initiative (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  T. A. Ramelot, J. R. Cort, G. T. Montelione, M. A. Kennedy
Nmr Solution Structure Of Homodimer Protein So_2176 From Shewanella Oneidensis. Northeast Structural Genomics Consortium Target Sor77.
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - UPF0352 PROTEIN SO_2176
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET21
    Expression System Strain: BL21(DE3)PMGK
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: SO_2176
    Organism Scientific: SHEWANELLA ONEIDENSIS
    Organism Taxid: 211586
    Strain: MR-1

 Structural Features

(-) Chains, Units

  12
NMR Structure (20x): AB
NMR Structure * (1x): AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2JUW)

(-) Sites  (0, 0)

(no "Site" information available for 2JUW)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2JUW)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2JUW)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2JUW)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2JUW)

(-) Exons   (0, 0)

(no "Exon" information available for 2JUW)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:80
 aligned with Y2176_SHEON | Q8EF26 from UniProtKB/Swiss-Prot  Length:72

    Alignment length:80
                                                                                                  72        
                                    10        20        30        40        50        60        70 |       -
           Y2176_SHEON    1 MAIQSKYSNTQVESLIAEILVVLEKHKAPTDLSLMALGNCVTHLLERKVPSESRQAVAEQFAKALAQSVKSN--------  -
               SCOP domains d2juwa1 A:1-72 Uncharacterized protein SO2176                           -------- SCOP domains
               CATH domains -------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------- Transcript
                  2juw A  1 MAIQSKYSNTQVESLIAEILVVLEKHKAPTDLSLMALGNCVTHLLERKVPSESRQAVAEQFAKALAQSVKSNLEHHHHHH 80
                                    10        20        30        40        50        60        70        80


Chain B from PDB  Type:PROTEIN  Length:80
 aligned with Y2176_SHEON | Q8EF26 from UniProtKB/Swiss-Prot  Length:72

    Alignment length:80
                                                                                                  72        
                                    10        20        30        40        50        60        70 |       -
           Y2176_SHEON    1 MAIQSKYSNTQVESLIAEILVVLEKHKAPTDLSLMALGNCVTHLLERKVPSESRQAVAEQFAKALAQSVKSN--------  -
               SCOP domains d2juwb_ B: Uncharacterized protein SO2176                                        SCOP domains
               CATH domains -------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) -------------------------DUF1414-2juwB01 B:26-69                     ----------- Pfam domains (1)
           Pfam domains (2) -------------------------DUF1414-2juwB02 B:26-69                     ----------- Pfam domains (2)
         Sec.struct. author .......hhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------- Transcript
                  2juw B  1 MAIQSKYSNTQVESLIAEILVVLEKHKAPTDLSLMALGNCVTHLLERKVPSESRQAVAEQFAKALAQSVKSNLEHHHHHH 80
                                    10        20        30        40        50        60        70        80
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

NMR Structure
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2JUW)

(-) Pfam Domains  (1, 2)

NMR Structure
(-)
Clan: no clan defined [family: DUF1414] (5)

(-) Gene Ontology  (3, 3)

NMR Structure(hide GO term definitions)
Chain A,B   (Y2176_SHEON | Q8EF26)
molecular function
    GO:0003674    molecular_function    Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
biological process
    GO:0008150    biological_process    Any process specifically pertinent to the functioning of integrated living units: cells, tissues, organs, and organisms. A process is a collection of molecular events with a defined beginning and end.
cellular component
    GO:0005575    cellular_component    The part of a cell, extracellular environment or virus in which a gene product is located. A gene product may be located in one or more parts of a cell and its location may be as specific as a particular macromolecular complex, that is, a stable, persistent association of macromolecules that function together.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2juw)
 
  Sites
(no "Sites" information available for 2juw)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2juw)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2juw
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Y2176_SHEON | Q8EF26
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Y2176_SHEON | Q8EF26
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        Y2176_SHEON | Q8EF26: 2qti

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2JUW)