|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 2JS5) |
(no "Site" information available for 2JS5) |
(no "SS Bond" information available for 2JS5) |
(no "Cis Peptide Bond" information available for 2JS5) |
(no "SAP(SNP)/Variant" information available for 2JS5) |
(no "PROSITE Motif" information available for 2JS5) |
(no "Exon" information available for 2JS5) |
NMR StructureChain A from PDB Type:PROTEIN Length:71 aligned with Q60C73_METCA | Q60C73 from UniProtKB/TrEMBL Length:63 Alignment length:71 63 10 20 30 40 50 60 | - Q60C73_METCA 1 MSEGAEELKAKLKKLNAQATALKMDLHDLAEDLPTGWNRIMEVAEKTYEAYRQLDEFRKSTAS-------- - SCOP domains ----------------------------------------------------------------------- SCOP domains CATH domains 2js5A00 A:1-71 Helix hairpin bin CATH domains Pfam domains ----------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------- Transcript 2js5 A 1 MSEGAEELKAKLKKLNAQATALKMDLHDLAEDLPTGWNRIMEVAEKTYEAYRQLDEFRKSTASLEHHHHHH 71 10 20 30 40 50 60 70 Chain B from PDB Type:PROTEIN Length:71 aligned with Q60C73_METCA | Q60C73 from UniProtKB/TrEMBL Length:63 Alignment length:71 63 10 20 30 40 50 60 | - Q60C73_METCA 1 MSEGAEELKAKLKKLNAQATALKMDLHDLAEDLPTGWNRIMEVAEKTYEAYRQLDEFRKSTAS-------- - SCOP domains ----------------------------------------------------------------------- SCOP domains CATH domains 2js5B00 B:1-71 Helix hairpin bin CATH domains Pfam domains (1) Rop-like-2js5B01 B:1-63 -------- Pfam domains (1) Pfam domains (2) Rop-like-2js5B02 B:1-63 -------- Pfam domains (2) SAPs(SNPs) ----------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------- Transcript 2js5 B 1 MSEGAEELKAKLKKLNAQATALKMDLHDLAEDLPTGWNRIMEVAEKTYEAYRQLDEFRKSTASLEHHHHHH 71 10 20 30 40 50 60 70
|
(no "SCOP Domain" information available for 2JS5) |
NMR Structure |
NMR Structure
|
NMR Structure(hide GO term definitions) Chain A,B (Q60C73_METCA | Q60C73)
|
|
|
|
|
|
|