|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2JRO) |
Sites (0, 0)| (no "Site" information available for 2JRO) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2JRO) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2JRO) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2JRO) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2JRO) |
Exons (0, 0)| (no "Exon" information available for 2JRO) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:74 aligned with Q8EJX2_SHEON | Q8EJX2 from UniProtKB/TrEMBL Length:70 Alignment length:74 70 10 20 30 40 50 60 70 Q8EJX2_SHEON 1 MRVFPVYAPKLIVKHARIFLTGVIWVKDLGRLEFEKGRFLLPRKSLPKVKQAILELNELIEAQNHQTKTA---- - SCOP domains -------------------------------------------------------------------------- SCOP domains CATH domains 2jroA01 A:1-65 so0334 like domain --------- CATH domains Pfam domains DUF1107-2jroA01 A:1-64 ---------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------- Transcript 2jro A 1 MRVFPVYAPKLIVKHARIFLTGVIWVKDLGRLEFEKGRFLLPRKSLPKVKQAILELNELIEAQNHQTKTALEHH 74 10 20 30 40 50 60 70
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2JRO) |
CATH Domains (1, 1)
NMR Structure
|
Pfam Domains (1, 1)
NMR Structure
|
Gene Ontology (3, 3)|
NMR Structure(hide GO term definitions) Chain A (Q8EJX2_SHEON | Q8EJX2)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|