|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2JLI) |
Sites (0, 0)| (no "Site" information available for 2JLI) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2JLI) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2JLI) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2JLI) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2JLI) |
Exons (0, 0)| (no "Exon" information available for 2JLI) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:100 aligned with YSCU_YERPE | P69986 from UniProtKB/Swiss-Prot Length:354 Alignment length:100 249 259 269 279 289 299 309 319 329 339 YSCU_YERPE 240 QFHQEIQSRNMRENVKRSSVVVANPTHIAIGILYKRGETPLPLVTFKYTDAQVQTVRKIAEEEGVPILQRIPLARALYWDALVDHYIPAEQIEATAEVLR 339 SCOP domains d2jlia_ A: automated matches SCOP domains CATH domains 2jliA00 A:240-339 secretion proteins EscU CATH domains Pfam domains Bac_export_2-2jliA01 A:240-339 Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------- Transcript 2jli A 240 QFHQEIQSRNMRENVKRSSVVVANPTHIAIGILYKRGETPLPLVTFKYTDAQVQTVRKIAEEEGVPILQRIPLARALYWDALVDHYIPAEQIEATAEVLR 339 249 259 269 279 289 299 309 319 329 339
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric/Biological Unit
|
CATH Domains (1, 1)
Asymmetric/Biological Unit
|
Pfam Domains (1, 1)
Asymmetric/Biological Unit
|
Gene Ontology (7, 7)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (YSCU_YERPE | P69986)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|