2IXT - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   SPHERICASE

Authors :   O. Almog, A. Gonzalez, N. Godin

Date :   11 Jul 06 (Deposition) - 21 Aug 07 (Release) - 10 Oct 12 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   0.80

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)

Keywords :   Serine Protease, Subtilisin Like Protease, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   O. Almog, A. Gonzalez, N. Godin, M. De Leeuw, M. J. Mekel, D. Klein, S. Braun, G. Shoham, R. L. Walter
The Crystal Structures Of The Psychrophilic Subtilisin S41 And The Mesophilic Subtilisin Sph Reveal The Same Calcium- Loaded State.
Proteins V. 74 489 2009
PubMed-ID: 18655058 | Reference-DOI: 10.1002/PROT.22175
(for further references see the PDB file header)

Molecule 1 - 36KDA PROTEASE
	Chains	:	A, B
	Fragment	:	RESIDUES 122-431
	Organism Scientific	:	BACILLUS SPHAERICUS
	Organism Taxid	:	1421

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 10)

No.	Name	Count	Type	Full Name
1	CA	10	Ligand/Ion	CALCIUM ION

Biological Unit 1 (0, 0)

No.	Name	Count	Type	Full Name
1	CA	-1	Ligand/Ion	CALCIUM ION

Biological Unit 2 (0, 0)

No.	Name	Count	Type	Full Name
1	CA	-1	Ligand/Ion	CALCIUM ION

Asymmetric Unit (10, 10)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	ASP A:287 , ILE A:288 , ALA A:295 , GLY A:297 , ASP A:299 , HOH A:2492	BINDING SITE FOR RESIDUE CA A1310
02	AC2	SOFTWARE	THR A:214 , ASP A:217 , VAL A:219 , GLN A:221 , ASP A:224 , HOH A:2487	BINDING SITE FOR RESIDUE CA A1311
03	AC3	SOFTWARE	ASN A:29 , GLU A:49 , ASP A:98 , HOH A:2075 , HOH A:2122 , HOH A:2123 , HOH A:2214 , HOH A:2264	BINDING SITE FOR RESIDUE CA A1312
04	AC4	SOFTWARE	ASP A:115 , HOH A:2136 , HOH A:2140 , HOH A:2141 , HOH A:2237 , HOH A:2238 , HOH A:2243	BINDING SITE FOR RESIDUE CA A1313
05	AC5	SOFTWARE	GLY A:181 , ALA A:182 , LEU A:183 , ALA A:186 , HOH A:2401 , HOH A:2405	BINDING SITE FOR RESIDUE CA A1314
06	AC6	SOFTWARE	ASP B:287 , ILE B:288 , ALA B:295 , GLY B:297 , ASP B:299 , HOH B:2499	BINDING SITE FOR RESIDUE CA B1311
07	AC7	SOFTWARE	THR B:214 , ASP B:217 , VAL B:219 , GLN B:221 , ASP B:224 , HOH B:2493	BINDING SITE FOR RESIDUE CA B1312
08	AC8	SOFTWARE	ASN B:29 , GLU B:49 , ASP B:98 , HOH B:2077 , HOH B:2112 , HOH B:2118 , HOH B:2264	BINDING SITE FOR RESIDUE CA B1313
09	AC9	SOFTWARE	ASP B:115 , HOH B:2127 , HOH B:2131 , HOH B:2132 , HOH B:2232 , HOH B:2236	BINDING SITE FOR RESIDUE CA B1314
10	BC1	SOFTWARE	GLY B:181 , ALA B:182 , LEU B:183 , ALA B:186 , HOH B:2408 , HOH B:2411	BINDING SITE FOR RESIDUE CA B1315

Asymmetric Unit

No.	Residues
1	A:51	-	A:65
2	B:51	-	B:65

Asymmetric Unit

No.	Residues
1	Gly A:171	-	Tyr A:172
2	Tyr A:179	-	Pro A:180
3	Gly B:171	-	Tyr B:172
4	Tyr B:179	-	Pro B:180

(no "SAP(SNP)/Variant" information available for 2IXT)

(no "PROSITE Motif" information available for 2IXT)

(no "Exon" information available for 2IXT)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:309
 aligned with Q9S3L6_LYSSH | Q9S3L6 from UniProtKB/TrEMBL  Length:431

    Alignment length:309
                                   131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421         
         Q9S3L6_LYSSH   122 RASQQIPWGIKAIYNNDTLTSTTGGSGINIAVLDTGVNTSHPDLVNNVEQCKDFTGATTPINNSCTDRNGHGTHVAGTALADGGSDQAGIYGVAPDADLWAYKVLLDSGSGYSDDIAAAIRHAADQATATGTKTIISMSLGSSANNSLISSAVNYAYSKGVLIVAAAGNSGYSQGTIGYPGALPNAIAVAALENVQQNGTYRVADYSSRGYISTAGDYVIQEGDIEISAPGSSVYSTWYNGGYNTISGTSMATPHVSGLAAKIWAENPSLSNTQLRSNLQERAKSVDIKGGYGAAIGDDYASGFGFARV 430
               SCOP domains d2ixta_ A: automated matches                                                                                                                                                                                                                                                                                          SCOP domains
               CATH domains 2ixtA00 A:1-309  [code=3.40.50.200, no name defined]                                                                                                                                                                                                                                                                  CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhhh.............eeeeee.............eeeeee.......ee.......hhhhhhhhhhhh................eeeeee........hhhhhhhhhhhhhhhhhhhh..eeeee.......hhhhhhhhhhhhhh..eeeee....................eeeeeeeeeee..eeee.......................eeee...eeee.....eeee.hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh........................ Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2ixt A   1 RASQQIPWGIKAIYNNDTLTSTTGGSGINIAVLDTGVNTSHPDLVNNVEQCKDFTGATTPINNSCTDRNGHGTHVAGTALADGGSDQAGIYGVAPDADLWAYKVLLDSGSGYSDDIAAAIRHAADQATATGTKTIISMSLGSSANNSLISSAVNYAYSKGVLIVAAAGNSGYSQGTIGYPGALPNAIAVAALENVQQNGTYRVADYSSRGYISTAGDYVIQEGDIEISAPGSSVYSTWYNGGYNTISGTSMATPHVSGLAAKIWAENPSLSNTQLRSNLQERAKSVDIKGGYGAAIGDDYASGFGFARV 309
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300

Chain B from PDB  Type:PROTEIN  Length:310
 aligned with Q9S3L6_LYSSH | Q9S3L6 from UniProtKB/TrEMBL  Length:431

    Alignment length:310
                                   131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431
         Q9S3L6_LYSSH   122 RASQQIPWGIKAIYNNDTLTSTTGGSGINIAVLDTGVNTSHPDLVNNVEQCKDFTGATTPINNSCTDRNGHGTHVAGTALADGGSDQAGIYGVAPDADLWAYKVLLDSGSGYSDDIAAAIRHAADQATATGTKTIISMSLGSSANNSLISSAVNYAYSKGVLIVAAAGNSGYSQGTIGYPGALPNAIAVAALENVQQNGTYRVADYSSRGYISTAGDYVIQEGDIEISAPGSSVYSTWYNGGYNTISGTSMATPHVSGLAAKIWAENPSLSNTQLRSNLQERAKSVDIKGGYGAAIGDDYASGFGFARVQ 431
               SCOP domains d2ixtb_ B: automated matches                                                                                                                                                                                                                                                                                           SCOP domains
               CATH domains 2ixtB00 B:1-310  [code=3.40.50.200, no name defined]                                                                                                                                                                                                                                                                   CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhhh.............eeeeee.........hhh.eeeeee.......ee.......hhhhhhhhhhhh................eeeeee........hhhhhhhhhhhhhhhhhhhh..eeeee.......hhhhhhhhhhhhhh..eeeee....................eeeeeeeeeee..eeee.......................eeee...eeee.....eeee.hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh......................... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2ixt B   1 RASQQIPWGIKAIYNNDTLTSTTGGSGINIAVLDTGVNTSHPDLVNNVEQCKDFTGATTPINNSCTDRNGHGTHVAGTALADGGSDQAGIYGVAPDADLWAYKVLLDSGSGYSDDIAAAIRHAADQATATGTKTIISMSLGSSANNSLISSAVNYAYSKGVLIVAAAGNSGYSQGTIGYPGALPNAIAVAALENVQQNGTYRVADYSSRGYISTAGDYVIQEGDIEISAPGSSVYSTWYNGGYNTISGTSMATPHVSGLAAKIWAENPSLSNTQLRSNLQERAKSVDIKGGYGAAIGDDYASGFGFARVQ 310
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: Subtilisin-like (227)

Superfamily: Subtilisin-like (227)

Family: Subtilases (190)

Protein domain: automated matches (58)

Bacillus sphaericus [TaxId: 1421] (2)

1a	d2ixta_	A:
1b	d2ixtb_	B:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Rossmann fold (7312)

Homologous Superfamily: [code=3.40.50.200, no name defined] (198)

Bacillus sphaericus. Organism_taxid: 1421 (1)

1a	2ixtA00	A:1-309
1b	2ixtB00	B:1-310

(no "Pfam Domain" information available for 2IXT)

Asymmetric Unit(hide GO term definitions)

Chain A,B (Q9S3L6_LYSSH | Q9S3L6)

molecular function
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0008233	peptidase activity	Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
	GO:0004252	serine-type endopeptidase activity	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
	GO:0008236	serine-type peptidase activity	Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
biological process
	GO:0006508	proteolysis	The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		BC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Gly A:171 - Tyr A:172	[ RasMol ]
		Gly B:171 - Tyr B:172	[ RasMol ]
		Tyr A:179 - Pro A:180	[ RasMol ]
		Tyr B:179 - Pro B:180	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2ixt
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	Q9S3L6_LYSSH \| Q9S3L6
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	Q9S3L6_LYSSH \| Q9S3L6
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/TrEMBL
	Q9S3L6_LYSSH \| Q9S3L6	:	1ea7 3d43

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 10)

Sites (10, 10)

SS Bonds (2, 2)

Cis Peptide Bonds (4, 4)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (6, 6)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File