Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF PROTEIN RRNAC1037 FROM HALOARCULA MARISMORTUI, PFAM DUF309
 
Authors :  V. N. Malashkevich, R. Toro, J. M. Sauder, K. D. Schwinn, D. A. Thompson, M. E. Rutter, M. Dickey, C. Groshong, K. T. Bain, J. M. Adams, C. Reyes, I. Rooney, A. Powell, A. Boice, T. Gheyi, S. Ozyurt, S. Atwell, S. R. Wasserman, S. Emtage, S. K. Burley, S. C. Almo, New York Sgx Research Center For Structural Genomics (Nysgxrc)
Date :  30 Sep 06  (Deposition) - 24 Oct 06  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.88
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Structural Genomics, Hypothetical Protein, Psi, Protein Structure Initiative, New York Sgx Research Center For Structural Genomics, Nysgxrc, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  V. N. Malashkevich, R. Toro, J. M. Sauder, D. A. Thompson, M. E. Rutter, M. Dickey, C. Groshong, K. T. Bain, J. M. Adams, C. Reyes, I. Rooney, A. Powell, A. Boice, T. Gheyi, S. Ozyurt, S. Atwell, S. R. Wasserman, K. D. Schwinn, S. Emtage, S. K. Burley, S. C. Almo
Crystal Structure Of The Hypothetical Protein From Haloarcula Marismortui
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - HYPOTHETICAL PROTEIN
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Organism Scientific: HALOARCULA MARISMORTUI
    Organism Taxid: 2238

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2IJQ)

(-) Sites  (0, 0)

(no "Site" information available for 2IJQ)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2IJQ)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2IJQ)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2IJQ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2IJQ)

(-) Exons   (0, 0)

(no "Exon" information available for 2IJQ)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:145
 aligned with Q5V3A0_HALMA | Q5V3A0 from UniProtKB/TrEMBL  Length:160

    Alignment length:145
                                    24        34        44        54        64        74        84        94       104       114       124       134       144       154     
         Q5V3A0_HALMA    15 GNPSGWRTDGQWEHETLRRAVVHGVRLYNSGEFHESHDCFEDEWYNYGRGNTESKFLHGMVQVAAGAYKHFDFEDDDGMRSLFRTSLQYFRGVPNDYYGVDLLDVRTTVTNALSDPSALHGWQIRLDGEYPTCRPEDIEFAESLE 159
               SCOP domains d2ijqa1 A:14-158 Hypothetical protein rrnAC1037                                                                                                   SCOP domains
               CATH domains 2ijqA00 A:14-158 TTHA0068-like                                                                                                                    CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....ee...ee.hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhh.............hhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2ijq A  14 GNPSGWRTDGQWEHETLRRAVVHGVRLYNSGEFHESHDCFEDEWYNYGRGNTESKFLHGMVQVAAGAYKHFDFEDDDGMRSLFRTSLQYFRGVPNDYYGVDLLDVRTTVTNALSDPSALHGWQIRLDGEYPTCRPEDIEFAESLE 158
                                    23        33        43        53        63        73        83        93       103       113       123       133       143       153     


Chain B from PDB  Type:PROTEIN  Length:118
 aligned with Q5V3A0_HALMA | Q5V3A0 from UniProtKB/TrEMBL  Length:160

    Alignment length:118
                                    35        45        55        65        75        85        95       105       115       125       135        
         Q5V3A0_HALMA    26 WEHETLRRAVVHGVRLYNSGEFHESHDCFEDEWYNYGRGNTESKFLHGMVQVAAGAYKHFDFEDDDGMRSLFRTSLQYFRGVPNDYYGVDLLDVRTTVTNALSDPSALHGWQIRLDGE 143
               SCOP domains d2ijqb_ B: automated matches                                                                                           SCOP domains
               CATH domains 2ijqB00 B:25-142 TTHA0068-like                                                                                         CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....ee..eehhhhhhhhhhhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------- Transcript
                 2ijq B  25 WEHETLRRAVVHGVRLYNSGEFHESHDCFEDEWYNYGRGNTESKFLHGMVQVAAGAYKHFDFEDDDGMRSLFRTSLQYFRGVPNDYYGVDLLDVRTTVTNALSDPSALHGWQIRLDGE 142
                                    34        44        54        64        74        84        94       104       114       124       134
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 2)

Asymmetric Unit
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2IJQ)

(-) Gene Ontology  (0, 0)

Asymmetric Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 2IJQ)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2ijq)
 
  Sites
(no "Sites" information available for 2ijq)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2ijq)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2ijq
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q5V3A0_HALMA | Q5V3A0
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q5V3A0_HALMA | Q5V3A0
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2IJQ)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2IJQ)