Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Biol.Unit 1 - manually
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Biol.Unit 1 - manually
Biol.Unit 1 - manually  (Jmol Viewer)
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE BRIC-A-BRAC (BTB) DOMAIN OF HUMAN BACH1
 
Authors :  A. L. Amos, A. P. Turnbull, G. Bunkoczi, E. Papagrigoriou, F. Gorrec, C. A. Bullock, F. Von Delft, J. Weigelt, A. Edwards, C. Arrowsmith, M. Su S. Knapp, Structural Genomics Consortium (Sgc)
Date :  26 Sep 06  (Deposition) - 31 Oct 06  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.44
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  C,D  (1x)
Biol. Unit 3:  A,B,C,D  (1x)
Keywords :  Bach1, Bric-A-Brac Domain, Transcription Factor, Protein-Protein Interaction, Cap'N'Collar Type Of Basic Region Leucine Zipper Factor Family, Structural Genomics, Structural Genomics Consortium, Sgc, Transcription (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. L. Amos, A. P. Turnbull, G. Bunkoczi, E. Papagrigoriou, F. Gorrec, C. Umeano, A. Bullock, F. Von Delft, J. Weigelt, A. Edwards, C. Arrowsmith, M. Sundstrom, S. Knapp
Crystal Structure Of The Bric-A-Brac (Btb) Domain Of Human Bach1
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - TRANSCRIPTION REGULATOR PROTEIN BACH1
    ChainsA, B, C, D
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPNIC28-BSA4
    Expression System StrainBL21(DE3)-R3
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneBACH1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymBTB AND CNC HOMOLOG 1, HA2303

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABCD
Biological Unit 1 (1x)AB  
Biological Unit 2 (1x)  CD
Biological Unit 3 (1x)ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2IHC)

(-) Sites  (0, 0)

(no "Site" information available for 2IHC)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2IHC)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2IHC)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2IHC)

(-) PROSITE Motifs  (1, 4)

Asymmetric Unit (1, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1BTBPS50097 BTB domain profile.BACH1_HUMAN34-100
 
 
 
  4A:34-100
B:34-100
C:34-100
D:34-100
Biological Unit 1 (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1BTBPS50097 BTB domain profile.BACH1_HUMAN34-100
 
 
 
  2A:34-100
B:34-100
-
-
Biological Unit 2 (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1BTBPS50097 BTB domain profile.BACH1_HUMAN34-100
 
 
 
  2-
-
C:34-100
D:34-100
Biological Unit 3 (1, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1BTBPS50097 BTB domain profile.BACH1_HUMAN34-100
 
 
 
  4A:34-100
B:34-100
C:34-100
D:34-100

(-) Exons   (2, 8)

Asymmetric Unit (2, 8)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.2ENST000003999212ENSE00001540806chr21:30671737-30671919183BACH1_HUMAN-00--
1.6ENST000003999216ENSE00001025546chr21:30693542-30693835294BACH1_HUMAN1-78784A:7-78 (gaps)
B:-1-78 (gaps)
C:0-78 (gaps)
D:7-78 (gaps)
72
77
73
72
1.7dENST000003999217dENSE00001025548chr21:30698380-306997141335BACH1_HUMAN79-5234454A:79-126
B:79-120
C:79-127
D:79-127
48
42
49
49
1.8ENST000003999218ENSE00001025547chr21:30701808-30702014207BACH1_HUMAN524-592690--
1.9ENST000003999219ENSE00001192071chr21:30714720-307184693750BACH1_HUMAN593-7361440--

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:117
 aligned with BACH1_HUMAN | O14867 from UniProtKB/Swiss-Prot  Length:736

    Alignment length:120
                                    16        26        36        46        56        66        76        86        96       106       116       126
          BACH1_HUMAN     7 SVFAYESSVHSTNVLLSLNDQRKKDVLCDVTIFVEGQRFRAHRSVLAACSSYFHSRIVGQADGELNITLPEEVTVKGFEPLIQFAYTAKLILSKENVDEVCKCVEFLSVHNIEESCFQFL 126
               SCOP domains d2ihca_ A: automated matches                                                                                             SCOP domains
               CATH domains --------2ihcA01 A:15-126 Potassium Channel Kv1.1; Chain A                                                                CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeee..hhhhhhhhhhhhhhhhh....eeeee..eeeeehhhhhhhhhhhhhhhhh..---.eeee.....hhhhhhhhhhhhhhheeeee..hhhhhhhhhhhhh....hhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ---------------------------BTB  PDB: A:34-100 UniProt: 34-100                                 -------------------------- PROSITE
               Transcript 1 Exon 1.6  PDB: A:7-78 (gaps) UniProt: 1-78 [INCOMPLETE]                 Exon 1.7d  PDB: A:79-126 UniProt: 79-523         Transcript 1
                 2ihc A   7 SVFAYESSVHSTNVLLSLNDQRKKDVLCDVTIFVEGQRFRAHRSVLAACSSYFHSRIVGQ---ELNITLPEEVTVKGFEPLIQFAYTAKLILSKENVDEVCKCVEFLSVHNIEESCFQFL 126
                                    16        26        36        46        56        66   |    76        86        96       106       116       126
                                                                                      66  70                                                        

Chain B from PDB  Type:PROTEIN  Length:113
 aligned with BACH1_HUMAN | O14867 from UniProtKB/Swiss-Prot  Length:736

    Alignment length:119
                                    11        21        31        41        51        61        71        81        91       101       111         
          BACH1_HUMAN     2 SLSENSVFAYESSVHSTNVLLSLNDQRKKDVLCDVTIFVEGQRFRAHRSVLAACSSYFHSRIVGQADGELNITLPEEVTVKGFEPLIQFAYTAKLILSKENVDEVCKCVEFLSVHNIEE 120
               SCOP domains d2i   hcb_ B: automated matches                                                                                         SCOP domains
               CATH domains ---   -------2ihcB01 B:15-120 Potassium Channel Kv1.1; Chain A                                                          CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...---eeeee..hhhhhhhhhhhhhhhhh....eeeee..eeeeehhhhhhhhhhhhhhhhh..---.eeee.....hhhhhhhhhhhhhhheeeee..hhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------BTB  PDB: B:34-100 UniProt: 34-100                                 -------------------- PROSITE
               Transcript 1 Exon 1.6  PDB: B:-1-78 (gaps) UniProt: 1-78 [INCOMPLETE]                     Exon 1.7d  PDB: B:79-120 UniProt: 79-523   Transcript 1
                 2ihc B  -1 SMS---VFAYESSVHSTNVLLSLNDQRKKDVLCDVTIFVEGQRFRAHRSVLAACSSYFHSRIVGQ---ELNITLPEEVTVKGFEPLIQFAYTAKLILSKENVDEVCKCVEFLSVHNIEE 120
                             ||   | 11        21        31        41        51        61    |   71        81        91       101       111         
                             0|   8                                                        66  70                                                  
                              7                                                                                                                    

Chain C from PDB  Type:PROTEIN  Length:117
 aligned with BACH1_HUMAN | O14867 from UniProtKB/Swiss-Prot  Length:736

    Alignment length:122
                                    15        25        35        45        55        65        75        85        95       105       115       125  
          BACH1_HUMAN     6 NSVFAYESSVHSTNVLLSLNDQRKKDVLCDVTIFVEGQRFRAHRSVLAACSSYFHSRIVGQADGELNITLPEEVTVKGFEPLIQFAYTAKLILSKENVDEVCKCVEFLSVHNIEESCFQFLK 127
               SCOP domains d2ihcc_ C: automated matches                                                                                               SCOP domains
               CATH domains ---------2ihcC01 C:15-127 Potassium Channel Kv1.1; Chain A                                                                 CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee..hhhhhhhhhhhhhhhhh....eeeee..eeeeehhhhhhhhhhhhhhhhh-----.eeee.....hhhhhhhhhhhhhhheeeee..hhhhhhhhhhhhh....hhhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------BTB  PDB: C:34-100 UniProt: 34-100                                 --------------------------- PROSITE
               Transcript 1 Exon 1.6  PDB: C:0-78 (gaps) UniProt: 1-78 [INCOMPLETE]                  Exon 1.7d  PDB: C:79-127 UniProt: 79-523          Transcript 1
                 2ihc C   0 MSVFAYESSVHSTNVLLSLNDQRKKDVLCDVTIFVEGQRFRAHRSVLAACSSYFHSRIV-----ELNITLPEEVTVKGFEPLIQFAYTAKLILSKENVDEVCKCVEFLSVHNIEESCFQFLK 127
                            ||      15        25        35        45        55        |-    |   75        85        95       105       115       125  
                            0|                                                       64    70                                                         
                             7                                                                                                                        

Chain D from PDB  Type:PROTEIN  Length:115
 aligned with BACH1_HUMAN | O14867 from UniProtKB/Swiss-Prot  Length:736

    Alignment length:121
                                    16        26        36        46        56        66        76        86        96       106       116       126 
          BACH1_HUMAN     7 SVFAYESSVHSTNVLLSLNDQRKKDVLCDVTIFVEGQRFRAHRSVLAACSSYFHSRIVGQADGELNITLPEEVTVKGFEPLIQFAYTAKLILSKENVDEVCKCVEFLSVHNIEESCFQFLK 127
               SCOP domains d2ihcd_ D: automated matches                                                                                              SCOP domains
               CATH domains --------2ihcD01 D:15-127 Potassium Channel Kv1.1; Chain A                                                                 CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee..hhhhhhhhhhhhhhhhh....eeeee..eeeeehhhhhhhhhhhhhhhhh------.eee.....hhhhhhhhhhhhhhheeeee..hhhhhhhhhhhhh....hhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------BTB  PDB: D:34-100 UniProt: 34-100                                 --------------------------- PROSITE
               Transcript 1 Exon 1.6  PDB: D:7-78 (gaps) UniProt: 1-78 [INCOMPLETE]                 Exon 1.7d  PDB: D:79-127 UniProt: 79-523          Transcript 1
                 2ihc D   7 SVFAYESSVHSTNVLLSLNDQRKKDVLCDVTIFVEGQRFRAHRSVLAACSSYFHSRIV------LNITLPEEVTVKGFEPLIQFAYTAKLILSKENVDEVCKCVEFLSVHNIEESCFQFLK 127
                                    16        26        36        46        56       | -    |   76        86        96       106       116       126 
                                                                                    64     71                                                        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric Unit

(-) CATH Domains  (1, 4)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2IHC)

(-) Gene Ontology  (24, 24)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (BACH1_HUMAN | O14867)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0000980    RNA polymerase II distal enhancer sequence-specific DNA binding    Interacting selectively and non-covalently with a RNA polymerase II (Pol II) distal enhancer. In mammalian cells, enhancers are distal sequences that increase the utilization of some promoters, and can function in either orientation and in any location (upstream or downstream) relative to the core promoter.
    GO:0020037    heme binding    Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0043565    sequence-specific DNA binding    Interacting selectively and non-covalently with DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.
    GO:0003700    transcription factor activity, sequence-specific DNA binding    Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
    GO:0001205    transcriptional activator activity, RNA polymerase II distal enhancer sequence-specific binding    Interacting selectively and non-covalently with a sequence of DNA that is in a distal enhancer region for RNA polymerase II (RNAP II) in order to activate or increase the frequency, rate or extent of transcription from the RNAP II promoter.
    GO:0001078    transcriptional repressor activity, RNA polymerase II core promoter proximal region sequence-specific binding    Interacting selectively and non-covalently with a sequence of DNA that is in cis with and relatively close to a core promoter for RNA polymerase II (RNAP II) in order to stop, prevent, or reduce the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0001206    transcriptional repressor activity, RNA polymerase II distal enhancer sequence-specific binding    Interacting selectively and non-covalently with a sequence of DNA that is in a distal enhancer region for RNA polymerase II (RNAP II) in order to stop, prevent, or reduce the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0004842    ubiquitin-protein transferase activity    Catalysis of the transfer of ubiquitin from one protein to another via the reaction X-Ub + Y --> Y-Ub + X, where both X-Ub and Y-Ub are covalent linkages.
biological process
    GO:0006281    DNA repair    The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
    GO:0000122    negative regulation of transcription from RNA polymerase II promoter    Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0045944    positive regulation of transcription from RNA polymerase II promoter    Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0016567    protein ubiquitination    The process in which one or more ubiquitin groups are added to a protein.
    GO:0061418    regulation of transcription from RNA polymerase II promoter in response to hypoxia    Any process that modulates the frequency, rate or extent of transcription from an RNA polymerase II promoter as a result of a hypoxia stimulus.
    GO:0000083    regulation of transcription involved in G1/S transition of mitotic cell cycle    Any process that regulates transcription such that the target genes are involved in the transition between G1 and S phase of the mitotic cell cycle.
    GO:0000117    regulation of transcription involved in G2/M transition of mitotic cell cycle    Any process that regulates transcription such that the target genes are transcribed as part of the G2/M transition of the mitotic cell cycle.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006366    transcription from RNA polymerase II promoter    The synthesis of RNA from a DNA template by RNA polymerase II, originating at an RNA polymerase II promoter. Includes transcription of messenger RNA (mRNA) and certain small nuclear RNAs (snRNAs).
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
cellular component
    GO:0031463    Cul3-RING ubiquitin ligase complex    A ubiquitin ligase complex in which a cullin from the Cul3 subfamily and a RING domain protein form the catalytic core; substrate specificity is conferred by a BTB-domain-containing protein.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2ihc)
 
  Sites
(no "Sites" information available for 2ihc)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2ihc)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2ihc
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  BACH1_HUMAN | O14867
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  BACH1_HUMAN | O14867
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2IHC)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2IHC)