Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  EXTRACELLULAR DOMAIN OF CRIG
 
Authors :  C. Wiesmann
Date :  12 Sep 06  (Deposition) - 07 Nov 06  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.20
Chains :  Asym./Biol. Unit :  A
Keywords :  Alternative Pathway, Complement Receptor, Ig Like Domain, Immune System (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  C. Wiesmann, K. J. Katschke, J. Yin, K. Y. Helmy, M. Steffek, W. J. Fairbrother, S. A. Mccallum, L. Embuscado, L. Deforge, P. E. Hass, M. Van Lookeren Campagne
Structure Of C3B In Complex With Crig Gives Insights Into Regulation Of Complement Activation.
Nature V. 444 217 2006
PubMed-ID: 17051150  |  Reference-DOI: 10.1038/NATURE05263
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - V-SET AND IMMUNOGLOBULIN DOMAIN-CONTAINING PROTEIN 4
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    FragmentEXTRACELLULAR DOMAIN OF CRIG
    GeneVSIG4
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymPROTEIN Z39IG

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2ICC)

(-) Sites  (0, 0)

(no "Site" information available for 2ICC)

(-) SS Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1A:22 -A:94

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2ICC)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (1, 1)

Asymmetric/Biological Unit (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_049956R108WVSIG4_HUMANPolymorphism34581041AR89W

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2ICC)

(-) Exons   (2, 2)

Asymmetric/Biological Unit (2, 2)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1bENST000003747371bENSE00001955049X:65259949-65259786164VSIG4_HUMAN1-19191A:0-01
1.2bENST000003747372bENSE00001022074X:65253672-65253316357VSIG4_HUMAN19-1381201A:0-118119
1.3aENST000003747373aENSE00001022073X:65252591-65252310282VSIG4_HUMAN138-232950--
1.4ENST000003747374ENSE00001022080X:65247954-6524789263VSIG4_HUMAN232-253220--
1.5ENST000003747375ENSE00002173390X:65247368-6524729178VSIG4_HUMAN253-279270--
1.6ENST000003747376ENSE00001022071X:65244971-65244867105VSIG4_HUMAN279-314360--
1.7aENST000003747377aENSE00001022076X:65242704-6524268322VSIG4_HUMAN314-32180--
1.8cENST000003747378cENSE00001906883X:65242342-65241580763VSIG4_HUMAN321-399790--

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:119
 aligned with VSIG4_HUMAN | Q9Y279 from UniProtKB/Swiss-Prot  Length:399

    Alignment length:119
                                    28        38        48        58        68        78        88        98       108       118       128         
          VSIG4_HUMAN    19 GRPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQK 137
               SCOP domains ----------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eeeee....eee..........eeeeeeeee......eeeeeee..eeee.hhhhh..eee.........eee...hhhhheeeeeeeeee.....eeeeeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------------------------------------------------W----------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1---------------------------------------------------------------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) Exon 1.2b  PDB: A:0-118 UniProt: 19-138 [INCOMPLETE]                                                                    Transcript 1 (2)
                 2icc A   0 GRPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQK 118
                                     9        19        29        39        49        59        69        79        89        99       109         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2ICC)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2ICC)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2ICC)

(-) Gene Ontology  (7, 7)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (VSIG4_HUMAN | Q9Y279)
molecular function
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0006957    complement activation, alternative pathway    Any process involved in the activation of any of the steps of the alternative pathway of the complement cascade which allows for the direct killing of microbes and the regulation of other immune processes.
    GO:0002376    immune system process    Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
    GO:0045087    innate immune response    Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
cellular component
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2icc)
 
  Sites
(no "Sites" information available for 2icc)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2icc)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2icc
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  VSIG4_HUMAN | Q9Y279
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  VSIG4_HUMAN | Q9Y279
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        VSIG4_HUMAN | Q9Y2792ice 2icf 5imk 5iml

(-) Related Entries Specified in the PDB File

2ice 2icf