|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2I9Y) |
Sites (0, 0)| (no "Site" information available for 2I9Y) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2I9Y) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2I9Y) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2I9Y) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2I9Y) |
Exons (0, 0)| (no "Exon" information available for 2I9Y) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:157 aligned with MLP28_ARATH | Q9SSK9 from UniProtKB/Swiss-Prot Length:335 Alignment length:157 26 36 46 56 66 76 86 96 106 116 126 136 146 156 166 MLP28_ARATH 17 TEASSLVGKLETDVEIKASADKFHHMFAGKPHHVSKASPGNIQGCDLHEGDWGTVGSIVFWNYVHDGEAKVAKERIEAVEPDKNLITFRVIEGDLMKEYKSFLLTIQVTPKPGGPGSIVHWHLEYEKISEEVAHPETLLQFCVEVSKEIDEHLLAEE 173 SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains 2i9yA00 A:17-173 [code=3.30.530.20, no name defined] CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 2i9y A 17 TEASSLVGKLETDVEIKASADKFHHMFAGKPHHVSKASPGNIQGCDLHEGDWGTVGSIVFWNYVHDGEAKVAKERIEAVEPDKNLITFRVIEGDLMKEYKSFLLTIQVTPKPGGPGSIVHWHLEYEKISEEVAHPETLLQFCVEVSKEIDEHLLAEE 173 26 36 46 56 66 76 86 96 106 116 126 136 146 156 166
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2I9Y) |
CATH Domains (1, 1)
NMR Structure
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2I9Y) |
Gene Ontology (2, 2)|
NMR Structure(hide GO term definitions) Chain A (MLP28_ARATH | Q9SSK9)
|
||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|