Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF PROTEIN TM1727 FROM THERMOTOGA MARITIMA
 
Authors :  M. Madegowda, S. Eswaramoorthy, J. Seetharaman, S. K. Burley, S. Swaminathan, New York Sgx Research Center For Structural Genomics (Nysgxrc)
Date :  30 Aug 06  (Deposition) - 03 Oct 06  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.00
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Nadp, Dehydrogenase, Tm1727, T1650, Structural Genomics, Psi-2, Protein Structure Initiative, New York Sgx Research Center For Structural Genomics, Nysgxrc, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. Madegowda, S. Eswaramoorthy, J. Seetharaman, S. K. Burley, S. Swaminathan, New York Sgx Research Center For Structural Genomics (Nysgxrc)
Crystal Structure Of Hypothetical Protein Tm1727 From Thermatoga Maritima
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - HYPOTHETICAL PROTEIN
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Organism ScientificTHERMOTOGA MARITIMA
    Organism Taxid2336

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 8)

Asymmetric/Biological Unit (2, 8)
No.NameCountTypeFull Name
1MSE6Mod. Amino AcidSELENOMETHIONINE
2NDP2Ligand/IonNADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDEPHOSPHATE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLY A:7 , THR A:8 , GLY A:9 , LEU A:11 , SER A:30 , ARG A:31 , ARG A:35 , VAL A:64 , PRO A:65 , ASP A:66 , TYR A:68 , ILE A:69 , CYS A:86 , SER A:87 , HIS A:104 , PRO A:105 , PHE A:107 , PHE A:109BINDING SITE FOR RESIDUE NDP A 301
2AC2SOFTWARETHR A:213 , ARG A:218 , GLY B:7 , THR B:8 , LEU B:11 , SER B:30 , ARG B:31 , ARG B:35 , VAL B:64 , PRO B:65 , ASP B:66 , TYR B:68 , ILE B:69 , CYS B:86 , SER B:87 , PRO B:105 , PHE B:107 , HOH B:310BINDING SITE FOR RESIDUE NDP B 301

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2I76)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2I76)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2I76)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2I76)

(-) Exons   (0, 0)

(no "Exon" information available for 2I76)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:247
 aligned with Q9X250_THEMA | Q9X250 from UniProtKB/TrEMBL  Length:264

    Alignment length:256
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251      
         Q9X250_THEMA     2 VLNFVGTGTLTRFFLECLKDRYEIGYILSRSIDRARNLAEVYGGKAATLEKHPELNGVVFVIVPDRYIKTVANHLNLGDAVLVHCSGFLSSEIFKKSGRASIHPNFSFSSLEKALEMKDQIVFGLEGDERGLPIVKKIAEEISGKYFVIPSEKKKAYHLAAVIASNFPVALAYLSKRIYTLLGLDEPELLIHTLMKGVADNIKKMRVECSLTGPVKRGDWQVVEEERREYEKIFGNTVLYDEIVKLLREVAESERR 257
               SCOP domains d2i76a2 A:2-154 Hyp    othetical protein TM1727                                                                                                          d2i76a1 A:155-257 Hypothetical protein TM1727                                                           SCOP domains
               CATH domains 2i76A01 A:2-153 NAD    (P)-binding Rossmann-like Domai   n                                                                                              2i76A02 A:154-257 ProC C-terminal domain-like                                                            CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee..hhhhhhhhhh..----...ee..hhhhhhhhhhhh............---.eee.....hhhhhhh........eee.....hhhhhh...eeeeee....--..hhhhhhhhh.eee.....hhhhhhhhhhhhh..eee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2i76 A   2 VLNFVGTGTLTRFFLECLK----IGYILSRSIDRARNLAEVYGGKAATLEKHPE---VVFVIVPDRYIKTVANHLNLGDAVLVHCSGFLSSEIFKKSGRASIHPNFSF--LEKALEmKDQIVFGLEGDERGLPIVKKIAEEISGKYFVIPSEKKKAYHLAAVIASNFPVALAYLSKRIYTLLGLDEPELLIHTLmKGVADNIKKmRVECSLTGPVKRGDWQVVEEERREYEKIFGNTVLYDEIVKLLREVAESERR 257
                                    11        |-   |    31        41        51   |   |61        71        81        91       101       | -|     |121       131       141       151       161       171       181       191    |  201    |  211       221       231       241       251      
                                             20   25                            55  59                                               109  |     |                                                                           196-MSE   206-MSE                                               
                                                                                                                                        112     |                                                                                                                                           
                                                                                                                                              118-MSE                                                                                                                                       

Chain B from PDB  Type:PROTEIN  Length:242
 aligned with Q9X250_THEMA | Q9X250 from UniProtKB/TrEMBL  Length:264

    Alignment length:253
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251   
         Q9X250_THEMA     2 VLNFVGTGTLTRFFLECLKDRYEIGYILSRSIDRARNLAEVYGGKAATLEKHPELNGVVFVIVPDRYIKTVANHLNLGDAVLVHCSGFLSSEIFKKSGRASIHPNFSFSSLEKALEMKDQIVFGLEGDERGLPIVKKIAEEISGKYFVIPSEKKKAYHLAAVIASNFPVALAYLSKRIYTLLGLDEPELLIHTLMKGVADNIKKMRVECSLTGPVKRGDWQVVEEERREYEKIFGNTVLYDEIVKLLREVAES 254
               SCOP domains d2i76b2 B:2-154 aut    omated matches                                                                                                                    d2i76b1 B:155-254 automated matches                                                                  SCOP domains
               CATH domains 2i76B01 B:2-153 NAD    (P)-binding Rossmann-like Domai   n                                                                                              2i76B02 B:154-254 ProC C-terminal domain-like                                                         CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..ee.....hhhhhhhhh.----.......hhhhhhhhhh..............---.ee...hhhhhhhhhh........eee..............eeeeee....--..hhhhhhhhh.eeee...hhhhhhhhhhhhhh..eee.--.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2i76 B   2 VLNFVGTGTLTRFFLECLK----IGYILSRSIDRARNLAEVYGGKAATLEKHPE---VVFVIVPDRYIKTVANHLNLGDAVLVHCSGFLSSEIFKKSGRASIHPNFSF--LEKALEmKDQIVFGLEGDERGLPIVKKIAEEISGKYFVI--EKKKAYHLAAVIASNFPVALAYLSKRIYTLLGLDEPELLIHTLmKGVADNIKKmRVECSLTGPVKRGDWQVVEEERREYEKIFGNTVLYDEIVKLLREVAES 254
                                    11        |-   |    31        41        51   |   |61        71        81        91       101       | -|     |121       131       141        |- |     161       171       181       191    |  201    |  211       221       231       241       251   
                                             20   25                            55  59                                               109  |     |                             150  |                                        196-MSE   206-MSE                                            
                                                                                                                                        112     |                                153                                                                                                     
                                                                                                                                              118-MSE                                                                                                                                    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (4, 4)

Asymmetric/Biological Unit

(-) CATH Domains  (2, 4)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2I76)

(-) Gene Ontology  (2, 2)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (Q9X250_THEMA | Q9X250)
molecular function
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NDP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2i76)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2i76
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9X250_THEMA | Q9X250
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q9X250_THEMA | Q9X250
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2I76)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2I76)