|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (1, 6)
|
(no "Site" information available for 2I4R) |
(no "SS Bond" information available for 2I4R) |
Asymmetric Unit
|
(no "SAP(SNP)/Variant" information available for 2I4R) |
(no "PROSITE Motif" information available for 2I4R) |
(no "Exon" information available for 2I4R) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:79 aligned with VATF_ARCFU | O29102 from UniProtKB/Swiss-Prot Length:101 Alignment length:79 10 20 30 40 50 60 70 VATF_ARCFU 1 MKKLAVVGDPDFTIGFMLAGISDIYEVTSDEEIVKAVEDVLKRDDVGVVIIKQEYLKKLPPVLRREIDEKVEPTFVSVG 79 SCOP domains ---d2i4ra1 A:4-79 V-type ATP synthase subunit F, AtpF SCOP domains CATH domains 2i4rA00 A:-2-79 v-type atp synthase like domains CATH domains Pfam domains ------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------- Transcript 2i4r A -2 SHmLAVVGDPDFTIGFmLAGISDIYEVTSDEEIVKAVEDVLKRDDVGVVImKQEYLKKLPPVLRREIDEKVEPTFVSVG 79 || 10 | 20 30 40 50| 60 70 || 17-MSE 51-MSE 0-MSE 4 Chain B from PDB Type:PROTEIN Length:80 aligned with VATF_ARCFU | O29102 from UniProtKB/Swiss-Prot Length:101 Alignment length:80 1 | 9 19 29 39 49 59 69 79 VATF_ARCFU - -MKKLAVVGDPDFTIGFMLAGISDIYEVTSDEEIVKAVEDVLKRDDVGVVIIKQEYLKKLPPVLRREIDEKVEPTFVSVG 79 SCOP domains d2i4rb_ B: V-type ATP synthase subunit F, AtpF SCOP domains CATH domains 2i4rB00 B:-3-79 v-type atp synthase like domains CATH domains Pfam domains -------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------- Transcript 2i4r B -3 HSHmLAVVGDPDFTIGFmLAGISDIYEVTSDEEIVKAVEDVLKRDDVGVVImKQEYLKKLPPVLRREIDEKVEPTFVSVG 79 || 9 |19 29 39 49 | 59 69 79 0-MSE 17-MSE 51-MSE 4
|
Asymmetric Unit |
Asymmetric Unit
|
(no "Pfam Domain" information available for 2I4R) |
Asymmetric Unit(hide GO term definitions) Chain A,B (VATF_ARCFU | O29102)
|
|
|
|
|
|
|