Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF CATALYTIC DOMAIN OF GOLDFISH RICH PROTEIN
 
Authors :  A. Y. Denisov, G. Kozlov, K. Gehring
Date :  18 Aug 06  (Deposition) - 06 Mar 07  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (10x)
Keywords :  Rich Protein, Cnp, 2', 3'-Cyclic-Nucleotide 3'- Phosphodiesterase, Nerve Regeneration, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  G. Kozlov, A. Y. Denisov, E. Pomerantseva, M. Gravel, P. E. Braun, K. Gehring
Solution Structure Of The Catalytic Domain Of Rich Protein From Goldfish.
Febs J. V. 274 1600 2007
PubMed-ID: 17480208  |  Reference-DOI: 10.1111/J.1742-4658.2007.05707.X
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - G-RICH
    Chains: A
    EC Number: 3.1.4.37
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21
    Expression System Plasmid: PET15B
    Expression System Strain: BL21
    Expression System Taxid: 511693
    Expression System Vector Type: PLASMID
    Organism Common: GOLDFISH
    Organism Scientific: CARASSIUS AURATUS
    Organism Taxid: 7957

 Structural Features

(-) Chains, Units

  
NMR Structure (10x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2I3E)

(-) Sites  (0, 0)

(no "Site" information available for 2I3E)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2I3E)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2I3E)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2I3E)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2I3E)

(-) Exons   (0, 0)

(no "Exon" information available for 2I3E)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:222
 aligned with Q90306_CARAU | Q90306 from UniProtKB/TrEMBL  Length:411

    Alignment length:222
                                   177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387  
         Q90306_CARAU   168 QKEPELPLFFGWFLLPEEEERIKCATMDFLKTLDTLEAFKEHISEFTGEAEKEVDLEQYFQNPLQLHCTTKFCDYGKAEGAKEYAELQVVKESLTKSYELSVTALIVTPRTFGARVALTEAQVKLWPEGADKEGVAPALLPSVEALPAGSRAHVTLGCSAGVETVQTGLDLLEILALQKEGKEGTQVEMDLGTLTYLSEGRWFLALREPINADTTFTSFSED 389
               SCOP domains d2i3ea_ A: automated matches                                                                                                                                                                                                   SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ........eeeeeehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhh......eeeeee.....hhhhhhhhhhhhhhhh...eeeeeeeeeee...eeeeeee.hhhhhhh..hhhhhh..hhhhhhhhh.......eeeeeee.....hhhhhhhhhhhhhhhhh....eeee...eeeee.....eeeeeeeeeeeeeeeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2i3e A   1 GSHMELPLFFGWFLLPEEEERIKCATMDFLKTLDTLEAFKEHISEFTGEAEKEVDLEQYFQNPLQLHCTTKFCDYGKAEGAKEYAELQVVKESLTKSYELSVTALIVTPRTFGARVALTEAQVKLWPEGADKEGVAPALLPSVEALPAGSRAHVTLGCSAGVETVQTGLDLLEILALQKEGKEGTQVEMDLGTLTYLSEGRWFLALREPINADTTFTSFSED 222
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2I3E)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2I3E)

(-) Gene Ontology  (3, 3)

NMR Structure(hide GO term definitions)
Chain A   (Q90306_CARAU | Q90306)
molecular function
    GO:0004113    2',3'-cyclic-nucleotide 3'-phosphodiesterase activity    Catalysis of the reaction: nucleoside 2',3'-cyclic phosphate + H2O = nucleoside 2'-phosphate.
biological process
    GO:0009214    cyclic nucleotide catabolic process    The chemical reactions and pathways resulting in the breakdown of a cyclic nucleotide, a nucleotide in which the phosphate group is in diester linkage to two positions on the sugar residue.
cellular component
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2i3e)
 
  Sites
(no "Sites" information available for 2i3e)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2i3e)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2i3e
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q90306_CARAU | Q90306
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  3.1.4.37
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q90306_CARAU | Q90306
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2I3E)

(-) Related Entries Specified in the PDB File

1woj CNPASE