|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 3)
Asymmetric Unit (1, 3)
|
Sites (3, 3)
Asymmetric Unit (3, 3)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2I0M) |
Cis Peptide Bonds (2, 2)
Asymmetric Unit
|
||||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2I0M) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2I0M) |
Exons (0, 0)| (no "Exon" information available for 2I0M) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:207 aligned with PHOU_STRPN | P0A3Y7 from UniProtKB/Swiss-Prot Length:216 Alignment length:212 13 23 33 43 53 63 73 83 93 103 113 123 133 143 153 163 173 183 193 203 213 PHOU_STRPN 4 QFDLELHELEQSFLGLGQLVLETASKALLALASKDKEMAELIINKDHAINQGQSAIELTCARLLALQQPQVSDLRFVISIMSSCSDLERMGDHMAGIAKAVLQLKENQLAPDEEQLHQMGKLSLSMLADLLVAFPLHQASKAISIAQKDEQIDQYYYALSKEIIGLMKDQETSIPNGTQYLYIIGHLERFADYIANICERLVYLETGELVDL 215 SCOP domains d2i0ma_ A: automated matches SCOP domains CATH domains 2i0mA01 A:4-111 Phosphate transport system protein phou homolog 2; domain 2 2i 0mA02 A:112-215 Phosphate transport system protein phou hom olog 2; domain 2 CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 2i0m A 4 QFDLELHELEQSFLGLGQLVLETASKALLALASKDKEMAELIINKDHAINQGQSAIELTCARLLAL--PQVSDLRFVISIMSSCSDLERMGDHMAGIAKAVLQLKENQLA--EEQLHQMGKLSLSMLADLLVAFPLHQASKAISIAQKDEQIDQYYYALSKEIIGLMKDQE-SIPNGTQYLYIIGHLERFADYIANICERLVYLETGELVDL 215 13 23 33 43 53 63 | 73 83 93 103 113 | 123 133 143 153 163 173| | 183 193 203 213 69 72 113 | 174 | 116 176
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (1, 2)| Asymmetric Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2I0M) |
Gene Ontology (7, 7)|
Asymmetric Unit(hide GO term definitions) Chain A (PHOU_STRPN | P0A3Y7)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|