Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF PEB3 FROM CAMPYLOBACTER JEJUNI
 
Authors :  E. S. Rangarajan, S. Bhatia, D. C. Watson, C. Munger, M. Cygler, A. Matte, N. M. Young, Montreal-Kingston Bacterial Structural Genomics Initiative (Bsgi)
Date :  04 Aug 06  (Deposition) - 01 May 07  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.60
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Peb3, Periplasmic Binding Protein, N-Glycosylation, Structural Genomics, Montreal-Kingston Bacterial Structural Genomics Initiative, Bsgi (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  E. S. Rangarajan, S. Bhatia, D. C. Watson, C. Munger, M. Cygler, A. Matte, N. M. Young
Structural Context For Protein N-Glycosylation In Bacteria: The Structure Of Peb3, An Adhesin From Campylobacter Jejuni.
Protein Sci. V. 16 990 2007
PubMed-ID: 17456748  |  Reference-DOI: 10.1110/PS.062737507
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - MAJOR ANTIGENIC PEPTIDE PEB3
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PCWORI+
    Expression System Strain: AD202
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: PEB3
    Organism Scientific: CAMPYLOBACTER JEJUNI
    Organism Taxid: 197
    Strain: NCTC 11168

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 4)

Asymmetric/Biological Unit (2, 4)
No.NameCountTypeFull Name
1FLC2Ligand/IonCITRATE ANION
2MSE2Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREPRO A:27 , GLY A:28 , GLY A:54 , PRO A:55 , ASN A:137 , THR A:138 , SER A:139 , PRO A:169 , ASN A:170 , SER A:171 , GLY A:172 , SER A:173 , HOH A:339 , HOH A:365 , HOH A:404 , HOH A:417 , HOH A:454BINDING SITE FOR RESIDUE FLC A 301
2AC2SOFTWAREPRO B:27 , GLY B:28 , GLY B:54 , PRO B:55 , ASN B:137 , THR B:138 , SER B:139 , PRO B:169 , ASN B:170 , SER B:171 , GLY B:172 , SER B:173 , HOH B:331 , HOH B:338 , HOH B:346 , HOH B:371BINDING SITE FOR RESIDUE FLC B 301

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2HXW)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2HXW)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2HXW)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2HXW)

(-) Exons   (0, 0)

(no "Exon" information available for 2HXW)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:229
 aligned with Q0PBL7_CAMJE | Q0PBL7 from UniProtKB/TrEMBL  Length:250

    Alignment length:231
                                                                                                                                                                                                                                                               250 
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250 
         Q0PBL7_CAMJE    21 DVNLYGPGGPHTALKDIANKYSEKTGVKVNVNFGPQATWFEKAKKDADILFGASDQSALAIASDFGKDFNVSKIKPLYFREAIILTQKGNPLKIKGLKDLANKKVRIVVPEGAGKSNTSGTGVWEDMIGRTQDIKTIQNFRNNIVAFVPNSGSARKLFAQDQADAWITWIDWSKSNPDIGTAVAIEKDLVVYRTFNVIAKEGASKETQDFIAYLSSKEAKEIFKKYGWRE-   -
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee...hhhhhhhhhhhhhhhhh..eeeee.hhhhhhhhhhhhh.eeee.hhhhhhhhhhhhhhhhhhhhheeeeeeeeeeee.........hhhhhhhh...eee............hhhhhhhhh..hhhhhhhhhhheeee.......--........eeeeehhhhhhh....eeee.......eeeeeeee....hhhhhhhhhhh.hhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2hxw A  21 DVNLYGPGGPHTALKDIANKYSEKTGVKVNVNFGPQATWFEKAKKDADILFGASDQSALAIASDFGKDFNVSKIKPLYFREAIILTQKGNPLKIKGLKDLANKKVRIVVPEGAGKSNTSGTGVWEDmIGRTQDIKTIQNFRNNIVAFVPNSGSA--LFAQDQADAWITWIDWSKSNPDIGTAVAIEKDLVVYRTFNVIAKEGASKETQDFIAYLSSKEAKEIFKKYGWREH 251
                                    30        40        50        60        70        80        90       100       110       120       130       140      |150       160       170   |  |180       190       200       210       220       230       240       250 
                                                                                                                                                        147-MSE                    174  |                                                                          
                                                                                                                                                                                      177                                                                          


Chain B from PDB  Type:PROTEIN  Length:230
 aligned with Q0PBL7_CAMJE | Q0PBL7 from UniProtKB/TrEMBL  Length:250

    Alignment length:230
                                                                                                                                                                                                                                                              250 
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241        |-
         Q0PBL7_CAMJE    22 VNLYGPGGPHTALKDIANKYSEKTGVKVNVNFGPQATWFEKAKKDADILFGASDQSALAIASDFGKDFNVSKIKPLYFREAIILTQKGNPLKIKGLKDLANKKVRIVVPEGAGKSNTSGTGVWEDMIGRTQDIKTIQNFRNNIVAFVPNSGSARKLFAQDQADAWITWIDWSKSNPDIGTAVAIEKDLVVYRTFNVIAKEGASKETQDFIAYLSSKEAKEIFKKYGWRE-   -
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee...hhhhhhhhhhhhhhhhh...eeee.hhhhhhhhhhhhh.eeee.hhhhhhhhhh......hhhhheeeeeeeeeeee.........hhhhhhhh...eee............hhhhhhhhh..hhhhhhhhhhheeee.................eeeeehhhhhhh....eeee.......eeeeeeee....hhhhhhhhhhh.hhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2hxw B  22 VNLYGPGGPHTALKDIANKYSEKTGVKVNVNFGPQATWFEKAKKDADILFGASDQSALAIASDFGKDFNVSKIKPLYFREAIILTQKGNPLKIKGLKDLANKKVRIVVPEGAGKSNTSGTGVWEDmIGRTQDIKTIQNFRNNIVAFVPNSGSARKLFAQDQADAWITWIDWSKSNPDIGTAVAIEKDLVVYRTFNVIAKEGASKETQDFIAYLSSKEAKEIFKKYGWREH 251
                                    31        41        51        61        71        81        91       101       111       121       131       141     | 151       161       171       181       191       201       211       221       231       241       251
                                                                                                                                                       147-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2HXW)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2HXW)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2HXW)

(-) Gene Ontology  (3, 3)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (Q0PBL7_CAMJE | Q0PBL7)
molecular function
    GO:0015419    ATPase-coupled sulfate transmembrane transporter activity    Catalysis of the transfer of a solute or solutes from one side of a membrane to the other according to the reaction: ATP + H2O + sulfate(out) = ADP + phosphate + sulfate(in).
biological process
    GO:1902358    sulfate transmembrane transport    The directed movement of sulfate across a membrane.
    GO:0008272    sulfate transport    The directed movement of sulfate into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    FLC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2hxw)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2hxw
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q0PBL7_CAMJE | Q0PBL7
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q0PBL7_CAMJE | Q0PBL7
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q0PBL7_CAMJE | Q0PBL7: 3fir 3fj7 3fjg 3fjm

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2HXW)