2HCR - JenaLib

Biol.Unit 1 - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF HUMAN PHOSPHORIBOSYL PYROPHOSPHATE SYNTHETASE 1 IN COMPLEX WITH AMP(ATP), CADMIUM AND SULFATE ION

Authors :   S. Li, B. Peng, J. Ding

Date :   18 Jun 06 (Deposition) - 24 Oct 06 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.20

Chains :   Asym. Unit : A,B
Biol. Unit 1: A,B  (3x)

Keywords :   Prs1, Prpp Synthetase 1, Phosphoribosyl Pyrophosphate 1, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   S. Li, Y. Lu, B. Peng, J. Ding
Crystal Structure Of Human Phosphoribosylpyrophosphate Synthetase 1 Reveals A Novel Allosteric Site
Biochem. J. V. 401 39 2007
PubMed-ID: 16939420 | Reference-DOI: 10.1042/BJ20061066

Molecule 1 - RIBOSE-PHOSPHATE PYROPHOSPHOKINASE I
	Chains	:	A, B
	EC Number	:	2.7.6.1
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	PET-22B(+)
	Expression System Strain	:	BL-21(DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Gene	:	PRPS1
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	PHOSPHORIBOSYL PYROPHOSPHATE SYNTHETASE I, PRS-I, PPRIBP, PRPP SYNTHETASE 1

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (3x)	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (3, 10)

No.	Name	Count	Type	Full Name
1	AMP	2	Ligand/Ion	ADENOSINE MONOPHOSPHATE
2	CD	2	Ligand/Ion	CADMIUM ION
3	SO4	6	Ligand/Ion	SULFATE ION

Biological Unit 1 (2, 24)

No.	Name	Count	Type	Full Name
1	AMP	6	Ligand/Ion	ADENOSINE MONOPHOSPHATE
2	CD	-1	Ligand/Ion	CADMIUM ION
3	SO4	18	Ligand/Ion	SULFATE ION

Asymmetric Unit (10, 10)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	SER A:47 , ARG A:49 , SER A:308 , VAL A:309 , SER A:310 , HOH A:3004 , HOH A:3029 , ARG B:104	BINDING SITE FOR RESIDUE SO4 A 1001
02	AC2	SOFTWARE	ARG A:104 , SER B:47 , ARG B:49 , SER B:308 , VAL B:309 , SER B:310 , HOH B:3004	BINDING SITE FOR RESIDUE SO4 B 1002
03	AC3	SOFTWARE	ASP B:224 , THR B:225 , CYS B:226 , GLY B:227 , THR B:228 , HOH B:3040 , HOH B:3071	BINDING SITE FOR RESIDUE SO4 B 1003
04	AC4	SOFTWARE	ASP A:224 , THR A:225 , CYS A:226 , GLY A:227 , THR A:228 , HOH A:3050 , HOH A:3054	BINDING SITE FOR RESIDUE SO4 A 1004
05	AC5	SOFTWARE	LYS A:99 , LYS A:100 , ASP A:101 , LYS A:102 , SER B:132 , GLN B:135 , ASN B:144 , TYR B:146 , HOH B:3079	BINDING SITE FOR RESIDUE SO4 B 1005
06	AC6	SOFTWARE	SER A:132 , GLN A:135 , ASN A:144 , TYR A:146 , HOH A:3003 , LYS B:99 , LYS B:100 , ASP B:101 , LYS B:102	BINDING SITE FOR RESIDUE SO4 A 1006
07	AC7	SOFTWARE	ASP B:171 , ASP B:220	BINDING SITE FOR RESIDUE CD B 2001
08	AC8	SOFTWARE	ASP A:171 , ASP A:220	BINDING SITE FOR RESIDUE CD A 2002
09	AC9	SOFTWARE	ARG A:96 , GLN A:97 , LYS A:99 , HIS A:130 , PHE B:35 , ASN B:37 , GLU B:39 , LYS B:176 , HOH B:3053	BINDING SITE FOR RESIDUE AMP A 3001
10	BC1	SOFTWARE	PHE A:35 , ASN A:37 , GLU A:39 , LYS A:176 , ARG B:96 , GLN B:97 , ASP B:101 , HIS B:130	BINDING SITE FOR RESIDUE AMP B 3002

(no "SS Bond" information available for 2HCR)

(no "Cis Peptide Bond" information available for 2HCR)

Asymmetric Unit (19, 38)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_072719	S	16	P	PRPS1_HUMAN	Disease	869025594	A/B	S	16	P
02	UniProt	VAR_036941	E	43	D	PRPS1_HUMAN	Disease (CMTX5)	80338731	A/B	E	43	D
03	UniProt	VAR_016044	D	52	H	PRPS1_HUMAN	Disease (PRPS1 superactivity)	137852542	A/B	D	52	H
04	UniProt	VAR_063522	D	65	N	PRPS1_HUMAN	Disease (DFNX1)	180177151	A/B	D	65	N
05	UniProt	VAR_063523	A	87	T	PRPS1_HUMAN	Disease (DFNX1)	180177152	A/B	A	87	T
06	UniProt	VAR_004163	N	114	S	PRPS1_HUMAN	Disease (PRPS1 superactivity)	137852540	A/B	N	114	S
07	UniProt	VAR_036942	M	115	T	PRPS1_HUMAN	Disease (CMTX5)	80338732	A/B	M	115	T
08	UniProt	VAR_016045	L	129	I	PRPS1_HUMAN	Disease (PRPS1 superactivity)	137852543	A/B	L	129	I
09	UniProt	VAR_036943	Q	133	P	PRPS1_HUMAN	Disease (ARTS)	80338675	A/B	Q	133	P
10	UniProt	VAR_078489	V	142	L	PRPS1_HUMAN	Disease	398122855	A/B	V	142	L
11	UniProt	VAR_036944	L	152	P	PRPS1_HUMAN	Disease (ARTS)	80338676	A/B	L	152	P
12	UniProt	VAR_004164	D	183	H	PRPS1_HUMAN	Disease (PRPS1 superactivity)	137852541	A/B	D	183	H
13	UniProt	VAR_016046	A	190	V	PRPS1_HUMAN	Disease (PRPS1 superactivity)	137852544	A/B	A	190	V
14	UniProt	VAR_016047	H	193	Q	PRPS1_HUMAN	Disease (PRPS1 superactivity)	137852545	A/B	H	193	Q
15	UniProt	VAR_036593	D	203	H	PRPS1_HUMAN	Unclassified	---	A/B	D	203	H
16	UniProt	VAR_036594	V	219	G	PRPS1_HUMAN	Unclassified	---	A/B	V	219	G
17	UniProt	VAR_036595	H	231	D	PRPS1_HUMAN	Unclassified	---	A/B	H	231	D
18	UniProt	VAR_063524	I	290	T	PRPS1_HUMAN	Disease (DFNX1)	180177153	A/B	I	290	T
19	UniProt	VAR_063525	G	306	R	PRPS1_HUMAN	Disease (DFNX1)	180177154	A/B	G	306	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (19, 114)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_072719	S	16	P	PRPS1_HUMAN	Disease	869025594	A/B	S	16	P
02	UniProt	VAR_036941	E	43	D	PRPS1_HUMAN	Disease (CMTX5)	80338731	A/B	E	43	D
03	UniProt	VAR_016044	D	52	H	PRPS1_HUMAN	Disease (PRPS1 superactivity)	137852542	A/B	D	52	H
04	UniProt	VAR_063522	D	65	N	PRPS1_HUMAN	Disease (DFNX1)	180177151	A/B	D	65	N
05	UniProt	VAR_063523	A	87	T	PRPS1_HUMAN	Disease (DFNX1)	180177152	A/B	A	87	T
06	UniProt	VAR_004163	N	114	S	PRPS1_HUMAN	Disease (PRPS1 superactivity)	137852540	A/B	N	114	S
07	UniProt	VAR_036942	M	115	T	PRPS1_HUMAN	Disease (CMTX5)	80338732	A/B	M	115	T
08	UniProt	VAR_016045	L	129	I	PRPS1_HUMAN	Disease (PRPS1 superactivity)	137852543	A/B	L	129	I
09	UniProt	VAR_036943	Q	133	P	PRPS1_HUMAN	Disease (ARTS)	80338675	A/B	Q	133	P
10	UniProt	VAR_078489	V	142	L	PRPS1_HUMAN	Disease	398122855	A/B	V	142	L
11	UniProt	VAR_036944	L	152	P	PRPS1_HUMAN	Disease (ARTS)	80338676	A/B	L	152	P
12	UniProt	VAR_004164	D	183	H	PRPS1_HUMAN	Disease (PRPS1 superactivity)	137852541	A/B	D	183	H
13	UniProt	VAR_016046	A	190	V	PRPS1_HUMAN	Disease (PRPS1 superactivity)	137852544	A/B	A	190	V
14	UniProt	VAR_016047	H	193	Q	PRPS1_HUMAN	Disease (PRPS1 superactivity)	137852545	A/B	H	193	Q
15	UniProt	VAR_036593	D	203	H	PRPS1_HUMAN	Unclassified	---	A/B	D	203	H
16	UniProt	VAR_036594	V	219	G	PRPS1_HUMAN	Unclassified	---	A/B	V	219	G
17	UniProt	VAR_036595	H	231	D	PRPS1_HUMAN	Unclassified	---	A/B	H	231	D
18	UniProt	VAR_063524	I	290	T	PRPS1_HUMAN	Disease (DFNX1)	180177153	A/B	I	290	T
19	UniProt	VAR_063525	G	306	R	PRPS1_HUMAN	Disease (DFNX1)	180177154	A/B	G	306	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PRPP_SYNTHASE	PS00114	Phosphoribosyl pyrophosphate synthase signature.	PRPS1_HUMAN	128-143	2	A:128-143 B:128-143

Biological Unit 1 (1, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PRPP_SYNTHASE	PS00114	Phosphoribosyl pyrophosphate synthase signature.	PRPS1_HUMAN	128-143	6	A:128-143 B:128-143

Asymmetric Unit (7, 14)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1b	ENST00000372435	1b	ENSE00001947916	X:106871737-106871980	244	PRPS1_HUMAN	1-41	41	2	A:3-41 B:3-41	39 39
1.2a	ENST00000372435	2a	ENSE00001708019	X:106882525-106882708	184	PRPS1_HUMAN	41-102	62	2	A:41-102 B:41-102	62 62
1.3a	ENST00000372435	3a	ENSE00001668533	X:106884132-106884230	99	PRPS1_HUMAN	103-135	33	2	A:103-135 B:103-135	33 33
1.4	ENST00000372435	4	ENSE00001201231	X:106885596-106885720	125	PRPS1_HUMAN	136-177	42	2	A:136-177 B:136-177	42 42
1.5	ENST00000372435	5	ENSE00001201225	X:106888407-106888580	174	PRPS1_HUMAN	177-235	59	2	A:177-235 (gaps) B:177-235 (gaps)	59 59
1.6	ENST00000372435	6	ENSE00001201218	X:106890836-106890995	160	PRPS1_HUMAN	235-288	54	2	A:235-288 B:235-288	54 54
1.7b	ENST00000372435	7b	ENSE00001457786	X:106893170-106894256	1087	PRPS1_HUMAN	289-318	30	2	A:289-313 B:289-317	25 29

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:305
 aligned with PRPS1_HUMAN | P60891 from UniProtKB/Swiss-Prot  Length:318

    Alignment length:311
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312 
          PRPS1_HUMAN     3 NIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLF 313
               SCOP domains d2hcra1 A:3-160 automated matches                                                                                                                             d2hcra2 A:161-313 automated matches                                                                                                                       SCOP domains
               CATH domains 2hcrA01 A:3-146,A:291-311  [code=3.40.50.2020, no name defined]                                                                                 ------------------------------------------------------------------------------------------------------------------------------------------------2hcrA01              -- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee....hhhhhhhhhhh......eeeee.....eeeee.......eeeee.....hhhhhhhhhhhhhhhhhhh...eeeeee.................hhhhhhhhhhhhhh..eeeee...hhhhhhhh...eeee.hhhhhhhhhhhhh.hhhh.eeee....hhhhhhhhhhhh..eeeeeee..------..eeee.......eeeeeeee..hhhhhhhhhhhhhh....eeeeeeee....hhhhhhhhh...eeeee....hhhhhh....eeee.hhhhhhhhhhhhhhh..hhhhh Sec.struct. author
                 SAPs(SNPs) -------------P--------------------------D--------H------------N---------------------T--------------------------ST-------------I---P--------L---------P------------------------------H------V--Q---------H---------------G-----------D----------------------------------------------------------T---------------R------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------PRPP_SYNTHASE   -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1b  PDB: A:3-41 UniProt: 1-41   -------------------------------------------------------------Exon 1.3a  PDB: A:103-135        Exon 1.4  PDB: A:136-177 UniProt: 136-177 ---------------------------------------------------------Exon 1.6  PDB: A:235-288 UniProt: 235-288             Exon 1.7b  PDB: A:289-313 Transcript 1 (1)
           Transcript 1 (2) --------------------------------------Exon 1.2a  PDB: A:41-102 UniProt: 41-102                      --------------------------------------------------------------------------Exon 1.5  PDB: A:177-235 (gaps) UniProt: 177-235           ------------------------------------------------------------------------------ Transcript 1 (2)
                 2hcr A   3 NIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKER------DRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLF 313
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192   |     -|      212       222       232       242       252       262       272       282       292       302       312 
                                                                                                                                                                                                                           196    203

Chain B from PDB  Type:PROTEIN  Length:308
 aligned with PRPS1_HUMAN | P60891 from UniProtKB/Swiss-Prot  Length:318

    Alignment length:315
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312     
          PRPS1_HUMAN     3 NIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHVP 317
               SCOP domains d2hcrb1 B:3-160 automated matches                                                                                                                             d2hcrb2 B:161-317 automated matches                                                                                                                           SCOP domains
               CATH domains 2hcrB01 B:3-146,B:291-311  [code=3.40.50.2020, no name defined]                                                                                 ------------------------------------------------------------------------------------------------------------------------------------------------2hcrB01              ------ CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee....hhhhhhhhhhhh.....eeeee.....eeeee.......eeeee.....hhhhhhhhhhhhhhhhhhh...eeeeee.................hhhhhhhhhhhhhh..eeeee...hhhhhhhh...eeee.hhhhhhhhhhhhhhhhhh.eeee.hhhhhhhhhhhhhhhh.eeeeeee.-------..eeee.......eeeeeeee..hhhhhhhhhhhhhh....eeeeeeee....hhhhhhhh..eeeeeee....hhhhhhh...eeee.hhhhhhhhhhhhhhh..hhhhhh... Sec.struct. author
                 SAPs(SNPs) -------------P--------------------------D--------H------------N---------------------T--------------------------ST-------------I---P--------L---------P------------------------------H------V--Q---------H---------------G-----------D----------------------------------------------------------T---------------R----------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------PRPP_SYNTHASE   ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.1b  PDB: B:3-41 UniProt: 1-41   -------------------------------------------------------------Exon 1.3a  PDB: B:103-135        Exon 1.4  PDB: B:136-177 UniProt: 136-177 ---------------------------------------------------------Exon 1.6  PDB: B:235-288 UniProt: 235-288             Exon 1.7b  PDB: B:289-317     Transcript 1 (1)
           Transcript 1 (2) --------------------------------------Exon 1.2a  PDB: B:41-102 UniProt: 41-102                      --------------------------------------------------------------------------Exon 1.5  PDB: B:177-235 (gaps) UniProt: 177-235           ---------------------------------------------------------------------------------- Transcript 1 (2)
                 2hcr B   3 NIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKE-------DRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHVP 317
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192  |      -|      212       222       232       242       252       262       272       282       292       302       312     
                                                                                                                                                                                                                          195     203

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: PRTase-like (145)

Superfamily: PRTase-like (145)

Family: automated matches (39)

Protein domain: automated matches (39)

Human (Homo sapiens) [TaxId: 9606] (9)

1a	d2hcra1	A:3-160
1b	d2hcra2	A:161-313
1c	d2hcrb1	B:3-160
1d	d2hcrb2	B:161-317

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Rossmann fold (7312)

Homologous Superfamily: [code=3.40.50.2020, no name defined] (117)

Human (Homo sapiens) (19)

1a	2hcrA01	A:3-146,A:291-311
1b	2hcrB01	B:3-146,B:291-311

(no "Pfam Domain" information available for 2HCR)

Asymmetric Unit(hide GO term definitions)

Chain A,B (PRPS1_HUMAN | P60891)

molecular function
	GO:0043531	ADP binding	Interacting selectively and non-covalently with ADP, adenosine 5'-diphosphate.
	GO:0016208	AMP binding	Interacting selectively and non-covalently with AMP, adenosine monophosphate.
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0019003	GDP binding	Interacting selectively and non-covalently with GDP, guanosine 5'-diphosphate.
	GO:0030246	carbohydrate binding	Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates.
	GO:0016301	kinase activity	Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
	GO:0000287	magnesium ion binding	Interacting selectively and non-covalently with magnesium (Mg) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
	GO:0004749	ribose phosphate diphosphokinase activity	Catalysis of the reaction: D-ribose 5-phosphate + ATP = 5-phospho-alpha-D-ribose 1-diphosphate + AMP + 2 H(+).
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0006015	5-phosphoribose 1-diphosphate biosynthetic process	The chemical reactions and pathways resulting in the formation of 5-phosphoribose 1-diphosphate, also known as 5-phosphoribosyl-1-pyrophosphate.
	GO:0006167	AMP biosynthetic process	The chemical reactions and pathways resulting in the formation of AMP, adenosine monophosphate.
	GO:0031100	animal organ regeneration	The regrowth of a lost or destroyed animal organ.
	GO:0044249	cellular biosynthetic process	The chemical reactions and pathways resulting in the formation of substances, carried out by individual cells.
	GO:0046101	hypoxanthine biosynthetic process	The chemical reactions and pathways resulting in the formation of hypoxanthine, 6-hydroxy purine, an intermediate in the degradation of adenylate. Its ribonucleoside is known as inosine and its ribonucleotide as inosinate.
	GO:0007399	nervous system development	The process whose specific outcome is the progression of nervous tissue over time, from its formation to its mature state.
	GO:0009165	nucleotide biosynthetic process	The chemical reactions and pathways resulting in the formation of nucleotides, any nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the glycose moiety; may be mono-, di- or triphosphate; this definition includes cyclic-nucleotides (nucleoside cyclic phosphates).
	GO:0016310	phosphorylation	The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
	GO:0006144	purine nucleobase metabolic process	The chemical reactions and pathways involving purine nucleobases, one of the two classes of nitrogen-containing ring compounds found in DNA and RNA, which include adenine and guanine.
	GO:0006164	purine nucleotide biosynthetic process	The chemical reactions and pathways resulting in the formation of a purine nucleotide, a compound consisting of nucleoside (a purine base linked to a deoxyribose or ribose sugar) esterified with a phosphate group at either the 3' or 5'-hydroxyl group of the sugar.
	GO:0006221	pyrimidine nucleotide biosynthetic process	The chemical reactions and pathways resulting in the formation of a pyrimidine nucleotide, a compound consisting of nucleoside (a pyrimidine base linked to a deoxyribose or ribose sugar) esterified with a phosphate group at either the 3' or 5'-hydroxyl group of the sugar.
	GO:0009156	ribonucleoside monophosphate biosynthetic process	The chemical reactions and pathways resulting in the formation of a ribonucleoside monophosphate, a compound consisting of a nucleobase linked to a ribose sugar esterified with phosphate on the sugar.
	GO:0019693	ribose phosphate metabolic process	The chemical reactions and pathways involving ribose phosphate, any phosphorylated ribose sugar.
	GO:0034418	urate biosynthetic process	The chemical reactions and pathways resulting in the formation of urate, the anion of uric acid, 2,6,8-trioxypurine.
cellular component
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0043234	protein complex	A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.
	GO:0002189	ribose phosphate diphosphokinase complex	A protein complex having ribose phosphate diphosphokinase activity.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		AMP	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		CD	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		BC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2hcr)

Biological Unit
	Complete Structure
		Biological Unit 1	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2hcr
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	PRPS1_HUMAN \| P60891
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.7.6.1
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	300661
		Disease Information	:	OMIM
	301835
		Disease Information	:	OMIM
	304500
		Disease Information	:	OMIM
	311070
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	PRPS1_HUMAN \| P60891
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	PRPS1_HUMAN \| P60891	:	2h06 2h07 2h08 3efh 3s5j 4f8e 4lyg 4lzn 4lzo 4m0p 4m0u

2h06	ORIGINAL STRUCTURE BEFORE SOAKING THE SUBSTRATES

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 10)

Sites (10, 10)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (19, 38)

PROSITE Motifs (1, 2)

Exons (7, 14)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (30, 30)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File