Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  PY00414- PLASMODIUM YOELII THIOREDOXIN PEROXIDASE I
 
Authors :  J. Artz, W. Qiu, J. R. Min, A. Dong, J. Lew, M. Melone, Z. Alam, J. Weigelt, M. Sundstrom, A. M. Edwards, C. H. Arrowsmith, A. Bochkarev, R. Hui, Structural Genomics Consortium (Sgc)
Date :  12 May 06  (Deposition) - 30 May 06  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym./Biol. Unit :  A
Keywords :  Thioredoxin Peroxidase; Structural Genomics; Sgc, Structural Genomics Consortium, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. Artz, W. Qiu, J. R. Min, A. Dong, J. Lew, M. Melone, Z. Alam, J. Weigelt, M. Sundstrom, A. M. Edwards, C. H. Arrowsmith, A. Bochkarev, R. Hui
Crystal Structure Of Py00414 - A Plasmodium Yoelii Thioredoxin Peroxidase I
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - 2-CYS PEROXIREDOXIN
    Chains: A
    EC Number: 1.11.1.-
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Organism Scientific: PLASMODIUM YOELII
    Organism Taxid: 5861

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2H01)

(-) Sites  (0, 0)

(no "Site" information available for 2H01)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2H01)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2H01)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2H01)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2H01)

(-) Exons   (0, 0)

(no "Exon" information available for 2H01)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:174
 aligned with Q7RSE5_PLAYO | Q7RSE5 from UniProtKB/TrEMBL  Length:195

    Alignment length:175
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172     
         Q7RSE5_PLAYO     3 SIVGNQAPSFKAEAVFGDNTFGEVSLSDFIGKKYVLLYFYPLDFTFVCPSEIIALDKALDSFKERNVELLGCSVDSKFTHLAWKKTPLSQGGIGNIKHTLISDISKSIARSYDVLFNESVALRAFVLIDKQGVVQHLLVNNLALGRSVDEILRLIDALQHHEKYGDVCPANWQKG 177
               SCOP domains -----d2h01a1 A:2-171 Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin)                                                                                   SCOP domains
               CATH domains 2h01 A00 A:-2-171 Glutaredoxin                                                                                                                                                  CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....-.....eeeee.....eeeee.hhhh...eeeeee.........hhhhhhhhhhhhhhhhh.eeeeeee..hhhhhhhhhh.hhhhh.......eeee...hhhhhhh..ee...ee..eeeee.....eeeeee.hhhhhhhhhhhhhhhhhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2h01 A  -2 AFQG-QAPSFKAEAVFGDNTFGEVSLSDFIGKKYVLLYFYPLDFTFVCPSEIIALDKALDSFKERNVELLGCSVDSKFTHLAWKKTPLSQGGIGNIKHTLISDISKSIARSYDVLFNESVALRAFVLIDKQGVVQHLLVNNLALGRSVDEILRLIDALQHHEKYGDVCPANWQKG 171
                               | |   6        16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166     
                               1 2                                                                                                                                                                         


Chain A from PDB  Type:PROTEIN  Length:174
 aligned with Q86SB2_9APIC | Q86SB2 from UniProtKB/TrEMBL  Length:195

    Alignment length:175
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172     
         Q86SB2_9APIC     3 SIVGNQAPSFKAEAVFGDNTFGEVSLSDFIGKKYVLLYFYPLDFTFVCPSEIIALDKALDSFKERNVELLGCSVDSKFTHLAWKKTPLSQGGIGNIKHTLISDISKSIARSYDVLFNESVALRAFVLIDKQGVVQHLLVNNLALGRSVDEILRLIDALQHHEKYGDVCPANWQKG 177
               SCOP domains -----d2h01a1 A:2-171 Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin)                                                                                   SCOP domains
               CATH domains 2h01 A00 A:-2-171 Glutaredoxin                                                                                                                                                  CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....-.....eeeee.....eeeee.hhhh...eeeeee.........hhhhhhhhhhhhhhhhh.eeeeeee..hhhhhhhhhh.hhhhh.......eeee...hhhhhhh..ee...ee..eeeee.....eeeeee.hhhhhhhhhhhhhhhhhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2h01 A  -2 AFQG-QAPSFKAEAVFGDNTFGEVSLSDFIGKKYVLLYFYPLDFTFVCPSEIIALDKALDSFKERNVELLGCSVDSKFTHLAWKKTPLSQGGIGNIKHTLISDISKSIARSYDVLFNESVALRAFVLIDKQGVVQHLLVNNLALGRSVDEILRLIDALQHHEKYGDVCPANWQKG 171
                               | |   6        16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166     
                               1 2
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2H01)

(-) Gene Ontology  (6, 12)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (Q7RSE5_PLAYO | Q7RSE5)
molecular function
    GO:0016209    antioxidant activity    Inhibition of the reactions brought about by dioxygen (O2) or peroxides. Usually the antioxidant is effective because it can itself be more easily oxidized than the substance protected. The term is often applied to components that can trap free radicals, thereby breaking the chain reaction that normally leads to extensive biological damage.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0004601    peroxidase activity    Catalysis of the reaction: donor + hydrogen peroxide = oxidized donor + 2 H2O.
    GO:0051920    peroxiredoxin activity    Catalysis of the reaction: 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH.
biological process
    GO:0098869    cellular oxidant detoxification    Any process carried out at the cellular level that reduces or removes the toxicity superoxide radicals or hydrogen peroxide.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

Chain A   (Q86SB2_9APIC | Q86SB2)
molecular function
    GO:0016209    antioxidant activity    Inhibition of the reactions brought about by dioxygen (O2) or peroxides. Usually the antioxidant is effective because it can itself be more easily oxidized than the substance protected. The term is often applied to components that can trap free radicals, thereby breaking the chain reaction that normally leads to extensive biological damage.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0004601    peroxidase activity    Catalysis of the reaction: donor + hydrogen peroxide = oxidized donor + 2 H2O.
    GO:0051920    peroxiredoxin activity    Catalysis of the reaction: 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH.
biological process
    GO:0098869    cellular oxidant detoxification    Any process carried out at the cellular level that reduces or removes the toxicity superoxide radicals or hydrogen peroxide.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2h01)
 
  Sites
(no "Sites" information available for 2h01)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2h01)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2h01
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q7RSE5_PLAYO | Q7RSE5
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
  Q86SB2_9APIC | Q86SB2
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.11.1.-
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q7RSE5_PLAYO | Q7RSE5
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  Q86SB2_9APIC | Q86SB2
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q7RSE5_PLAYO | Q7RSE5: 4l0w

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2H01)