2GT6 - JenaLib

Title :   SOLUTION STRUCTURE OF HUMAN CU(I) SCO1

Authors :   L. Banci, I. Bertini, V. Calderone, S. Ciofi-Baffoni, S. Mangani, P. Palumaa, M. Martinelli, S. Wang, Structural Proteomics In Europe (Spine)

Date :   27 Apr 06 (Deposition) - 06 Jun 06 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A

Keywords :   Thioredoxin-Like Fold, Metalloprotein, Structural Genomics, Structural Proteomics In Europe, Spine, Metal Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   L. Banci, I. Bertini, V. Calderone, S. Ciofi-Baffoni, S. Mangani, M. Martinelli, P. Palumaa, S. Wang
A Hint For The Function Of Human Sco1 From Different Structures.
Proc. Natl. Acad. Sci. Usa V. 103 8595 2006
PubMed-ID: 16735468 | Reference-DOI: 10.1073/PNAS.0601375103
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 1)

Sites (1, 1)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 1)

PROSITE Motifs (0, 0)

Exons (4, 4)

NMR Structure (4, 4)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000255390	1a	ENSE00001523689	chr17:10600885-10600552	334	SCO1_HUMAN	1-91	91	0	-	-
1.2	ENST00000255390	2	ENSE00000907744	chr17:10599148-10599058	91	SCO1_HUMAN	92-122	31	0	-	-
1.3b	ENST00000255390	3b	ENSE00000907743	chr17:10596278-10596081	198	SCO1_HUMAN	122-188	67	1	A:129-188	60
1.4	ENST00000255390	4	ENSE00000907742	chr17:10595281-10595189	93	SCO1_HUMAN	188-219	32	1	A:188-219	32
1.5	ENST00000255390	5	ENSE00000907741	chr17:10590159-10590044	116	SCO1_HUMAN	219-257	39	1	A:219-257	39
1.6b	ENST00000255390	6b	ENSE00001830664	chr17:10584570-10583654	917	SCO1_HUMAN	258-301	44	1	A:258-301	44

Sequences/Alignments

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:173
 aligned with SCO1_HUMAN | O75880 from UniProtKB/Swiss-Prot  Length:301

    Alignment length:173
                                   138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298   
           SCO1_HUMAN   129 RHIGKPLLGGPFSLTTHTGERKTDKDYLGQWLLIYFGFTHCPDVCPEELEKMIQVVDEIDSITTLPDLTPLFISIDPERDTKEAIANYVKEFSPKLVGLTGTREEVDQVARAYRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHMRPYRKKS 301
               SCOP domains d2gt6a_ A: automated matches                                                                                                                                                  SCOP domains
               CATH domains 2gt6A00 A:129-301 Glutaredoxin                                                                                                                                                CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .............eee....ee.hhhhh..eeeeeee.....hhhhhhhhhhhhhhhhhhhh.....eeeeeee......hhhhhhhhhhhhh...eeee.hhhhhhhhhhhh...eee..........eee..eeeee.....eeeeee...hhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------L------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.3b  PDB: A:129-188 UniProt: 122-188 [INCOMPLETE]     ------------------------------Exon 1.5  PDB: A:219-257               Exon 1.6b  PDB: A:258-301 UniProt: 258-301   Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------Exon 1.4  PDB: A:188-219        ---------------------------------------------------------------------------------- Transcript 1 (2)
                 2gt6 A 129 SFTGKPLLGGPFSLTTHTGERKTDKDYLGQWLLIYFGFTHCPDVCPEELEKMIQVVDEIDSITTLPDLTPLFISIDPERDTKEAIANYVKEFSPKLVGLTGTREEVDQVARAYRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHMRPYRKKS 301
                                   138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (0, 0)

Gene Ontology (11, 11)

NMR Structure(hide GO term definitions)

Chain A (SCO1_HUMAN | O75880)

molecular function
	GO:0005507	copper ion binding	Interacting selectively and non-covalently with copper (Cu) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0006878	cellular copper ion homeostasis	Any process involved in the maintenance of an internal steady state of copper ions at the level of a cell.
	GO:0006825	copper ion transport	The directed movement of copper (Cu) ions into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0006091	generation of precursor metabolites and energy	The chemical reactions and pathways resulting in the formation of precursor metabolites, substances from which energy is derived, and any process involved in the liberation of energy from these substances.
	GO:0008535	respiratory chain complex IV assembly	The aggregation, arrangement and bonding together of a set of components to form respiratory chain complex IV (also known as cytochrome c oxidase), the terminal member of the respiratory chain of the mitochondrion and some aerobic bacteria. Cytochrome c oxidases are multi-subunit enzymes containing from 13 subunits in the mammalian mitochondrial form to 3-4 subunits in the bacterial forms.
cellular component
	GO:0072492	host cell mitochondrial intermembrane space	The region between the inner and outer lipid bilayers of the host cell mitochondrial envelope.
	GO:0005743	mitochondrial inner membrane	The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0030016	myofibril	The contractile element of skeletal and cardiac muscle; a long, highly organized bundle of actin, myosin, and other proteins that contracts by a sliding filament mechanism.

Visualization

Interactive Views

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CU1	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2gt6)

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	2gt6
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	SCO1_HUMAN \| O75880
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	220110
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	SCO1_HUMAN \| O75880
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description