2GSQ - JenaLib

Title :   GLUTATHIONE S-TRANSFERASE FROM SQUID DIGESTIVE GLAND COMPLEXED WITH S-(3-IODOBENZYL)GLUTATHIONE

Authors :   X. Ji, R. N. Armstrong, G. L. Gilliland

Date :   14 Apr 95 (Deposition) - 12 Apr 96 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.20

Chains :   Asym. Unit : A
Biol. Unit 1: A  (2x)

Keywords :   Squid Digestive Gland, Sigma Class, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   X. Ji, E. C. Von Rosenvinge, W. W. Johnson, R. N. Armstrong, G. L. Gilliland
Location Of A Potential Transport Binding Site In A Sigma Class Glutathione Transferase By X-Ray Crystallography.
Proc. Natl. Acad. Sci. Usa V. 93 8208 1996
PubMed-ID: 8710848 | Reference-DOI: 10.1073/PNAS.93.16.8208
(for further references see the PDB file header)

Compounds

Molecule 1 - GLUTATHIONE S-TRANSFERASE
	Chains	:	A
	EC Number	:	2.5.1.18
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Gene	:	CDNA INSERT OF CLONE PGST5
	Expression System Plasmid	:	GST5/PET
	Expression System Strain	:	DH5A
	Expression System Taxid	:	562
	Gene	:	CDNA INSERT OF CLONE PGST5
	Organ	:	DIGESTIVE GLAND
	Organism Common	:	SLOANE'S SQUID
	Organism Scientific	:	OMMASTREPHES SLOANI
	Organism Taxid	:	6633
	Synonym	:	SQUID GST

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 3)

Sites (3, 3)

Asymmetric Unit (3, 3)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	VAL A:101 , VAL A:102 , LYS A:105 , VAL A:162 , PHE A:202 , GBI A:203	BINDING SITE FOR RESIDUE SO4 A 300
2	AC2	SOFTWARE	TYR A:7 , PHE A:8 , ARG A:13 , TRP A:38 , LYS A:42 , ALA A:49 , MET A:50 , PRO A:51 , GLN A:62 , SER A:63 , ASP A:96 , VAL A:102 , SO4 A:300 , HOH A:301 , HOH A:304 , HOH A:420 , HOH A:432	BINDING SITE FOR RESIDUE GBI A 203
3	AC3	SOFTWARE	ARG A:13 , VAL A:102 , LYS A:103 , PHE A:106 , ALA A:107 , ALA A:114 , VAL A:115 , GLN A:117 , ASN A:118 , HOH A:391 , HOH A:478	BINDING SITE FOR RESIDUE GBI A 204

SS Bonds (0, 0)

Cis Peptide Bonds (1, 1)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 1)

PROSITE Motifs (2, 2)

Asymmetric Unit (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	GST_NTER	PS50404	Soluble glutathione S-transferase N-terminal domain profile.	GST_NOTSL	2-79	1	A:1-78
2	GST_CTER	PS50405	Soluble glutathione S-transferase C-terminal domain profile.	GST_NOTSL	81-203	1	A:80-202

Biological Unit 1 (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	GST_NTER	PS50404	Soluble glutathione S-transferase N-terminal domain profile.	GST_NOTSL	2-79	2	A:1-78
2	GST_CTER	PS50405	Soluble glutathione S-transferase C-terminal domain profile.	GST_NOTSL	81-203	2	A:80-202

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:202
 aligned with GST_NOTSL | P46088 from UniProtKB/Swiss-Prot  Length:203

    Alignment length:202
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201  
            GST_NOTSL     2 PKYTLHYFPLMGRAELCRFVLAAHGEEFTDRVVEMADWPNLKATMYSNAMPVLDIDGTKMSQSMCIARHLAREFGLDGKTSLEKYRVDEITETLQDIFNDVVKIKFAPEAAKEAVQQNYEKSCKRLAPFLEGLLVSNGGGDGFFVGNSMTLADLHCYVALEVPLKHTPELLKDCPKIVALRKRVAECPKIAAYLKKRPVRDF 203
               SCOP domains d2gsqa2 A:1-75 Class sigma GST                                             d2gsqa1 A:76-202 Class sigma GST                                                                                                SCOP domains
               CATH domains 2gsqA01 A:1-78,A:187-202 Glutaredoxin                                         2gsqA02 A:79-186  [code=1.20.1050.10, no name defined]                                                      2gsqA01          CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee....hhhhhhhhhhhhh....eeee.....hhhhhhh.hhh...eeee..eee..hhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhh........hhhhhhhhhhhh.hhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------Y------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE GST_NTER  PDB: A:1-78 UniProt: 2-79                                           -GST_CTER  PDB: A:80-202 UniProt: 81-203                                                                                     PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2gsq A   1 PKYTLHYFPLMGRAELCRFVLAAHGEEFTDRVVEMADWPNLKATMYSNAMPVLDIDGTKMSQSMCIARHLAREFGLDGKTSLEKYRVDEITETLQDIFNDVVKIKFAPEAAKEAVQQNYEKSCKRLAPFLEGLLVSNGGGDGFFVGNSMTLADLHCYVALEVPLKHTPELLKDCPKIVALRKRVAECPKIAAYLKKRPVRDF 202
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (2, 2)

CATH Domains (2, 2)

Pfam Domains (0, 0)

Gene Ontology (3, 3)

Asymmetric Unit(hide GO term definitions)

Chain A (GST_NOTSL | P46088)

molecular function
	GO:0004364	glutathione transferase activity	Catalysis of the reaction: R-X + glutathione = H-X + R-S-glutathione. R may be an aliphatic, aromatic or heterocyclic group; X may be a sulfate, nitrile or halide group.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		GBI	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Met A:50 - Pro A:51	[ RasMol ]

Biological Unit
	Complete Structure
		Biological Unit 1	[ Jena3D ]

Still Images

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)
Insightii
	protein: ribbon, secondary structure; ligands: spacefill [ mono GIF format \| stereo GIF format ]
	protein: ribbon, sticks; ligand: spacefill [ mono GIF format \| stereo GIF format ]
	[ mono GIF format \| stereo GIF format ]
Setor
	protein: ribbon, secondary structure; lignads: sticks [ mono GIF format \| stereo GIF format ]
	protein: spacefill; ligands: sticks [ mono GIF format \| stereo GIF format ]
	protein: ribbon, labeling; ligands: sticks [ mono GIF format \| stereo GIF format ]
Distance Plot
	representative atom: CA [ mono GIF format \| mono PDF format ]

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	2gsq
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	GST_NOTSL \| P46088
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.5.1.18
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	GST_NOTSL \| P46088
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description