|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2GP8) |
Sites (0, 0)| (no "Site" information available for 2GP8) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2GP8) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2GP8) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2GP8) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2GP8) |
Exons (0, 0)| (no "Exon" information available for 2GP8) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:40 aligned with VG08_BPP22 | P26748 from UniProtKB/Swiss-Prot Length:303 Alignment length:40 273 283 293 303 VG08_BPP22 264 ITGDVSAANKDAIRKQMDAAASKGDVETYRKLKAKLKGIR 303 SCOP domains d2gp8a_ A: SCOP domains CATH domains 2gp8A00 A:264-303 CATH domains Pfam domains ---------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------- PROSITE Transcript ---------------------------------------- Transcript 2gp8 A 264 ITGDVSAANKDAIRKQMDAAASKGDVETYRKLKAKLKGIR 303 273 283 293 303
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (1, 1)| NMR Structure |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2GP8) |
Gene Ontology (0, 0)|
NMR Structure(hide GO term definitions)
(no "Gene Ontology" information available for 2GP8)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|