Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF PROBABLE ACETYLTRANSFERASE FROM AGROBACTERIUM TUMEFACIENS
 
Authors :  C. Chang, X. Xu, J. Gu, A. Savchenko, A. Edwards, A. Joachimiak, Midwest For Structural Genomics (Mcsg)
Date :  17 Mar 06  (Deposition) - 18 Apr 06  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.25
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  C,D  (1x)
Keywords :  Acetyltransferase, Agrobacterium Tumefaciens, Structural Genomics, Psi, Protein Structure Initiative, Midwest Center For Structural Genomics, Mcsg, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  C. Chang, X. Xu, A. Savchenko, A. Edwards, A. Joachimiak
Crystal Structure Of Probable Acetyltransferase From Agrobacterium Tumefaciens
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - PROBABLE ACETYLTRANSFERASE
    Chains: A, B, C, D
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Organism Scientific: AGROBACTERIUM TUMEFACIENS
    Organism Taxid: 358

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (1x): AB  
Biological Unit 2 (1x):   CD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 19)

Asymmetric Unit (2, 19)
No.NameCountTypeFull Name
1ACO3Ligand/IonACETYL COENZYME *A
2MSE16Mod. Amino AcidSELENOMETHIONINE
Biological Unit 1 (2, 10)
No.NameCountTypeFull Name
1ACO2Ligand/IonACETYL COENZYME *A
2MSE8Mod. Amino AcidSELENOMETHIONINE
Biological Unit 2 (2, 9)
No.NameCountTypeFull Name
1ACO1Ligand/IonACETYL COENZYME *A
2MSE8Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETYR A:34 , LEU A:35 , MSE A:91 , GLY A:92 , ILE A:93 , ARG A:98 , ASN A:99 , LYS A:100 , GLY A:101 , GLY A:103 , ALA A:104 , SER A:125 , VAL A:126 , ASN A:130 , ALA A:131 , ARG A:132 , ALA A:133 , ALA A:135 , LEU A:136 , TYR A:137 , LYS A:139 , HOH A:1304 , HOH A:1305 , HOH A:1311 , HOH A:1321 , HOH A:1350 , HOH A:1354 , HOH A:1423 , PRO B:95 , ALA B:96BINDING SITE FOR RESIDUE ACO A 1301
2AC2SOFTWAREPRO A:95 , ALA A:96 , HOH A:1326 , TYR B:34 , MSE B:91 , GLY B:92 , ILE B:93 , ARG B:98 , ASN B:99 , LYS B:100 , GLY B:101 , LEU B:102 , GLY B:103 , ALA B:104 , SER B:125 , ASN B:130 , ALA B:131 , ARG B:132 , ALA B:133 , ALA B:135 , LEU B:136 , TYR B:137 , LYS B:139 , HOH B:1303 , HOH B:1304 , HOH B:1307 , HOH B:1320 , HOH B:1335 , HOH B:1350 , HOH B:1377 , HOH B:1398 , HOH B:1402BINDING SITE FOR RESIDUE ACO B 1302
3AC3SOFTWAREARG B:32 , ASP B:155 , TYR C:34 , MSE C:91 , ILE C:93 , ARG C:98 , ASN C:99 , LYS C:100 , GLY C:101 , LEU C:102 , GLY C:103 , ALA C:104 , LEU C:124 , SER C:125 , ASN C:130 , ALA C:131 , ARG C:132 , ALA C:135 , TYR C:137 , LYS C:139 , HOH C:1321 , HOH C:1330 , HOH C:1373BINDING SITE FOR RESIDUE ACO C 1303

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2GE3)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric Unit
No.Residues
1Ala D:40 -Pro D:41

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2GE3)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2GE3)

(-) Exons   (0, 0)

(no "Exon" information available for 2GE3)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:164
 aligned with A9CI25_AGRFC | A9CI25 from UniProtKB/TrEMBL  Length:169

    Alignment length:164
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164    
         A9CI25_AGRFC     5 DTVTIKPIRAEHVESFHRALDAVSRERKYLSFLEAPPLEAVRAFVLDMIENDHPQFVAIADGDVIGWCDIRRQDRATRAHCGTLGMGILPAYRNKGLGARLMRRTLDAAHEFGLHRIELSVHADNARAIALYEKIGFAHEGRARDAVSIDGHYIDSLNMAIIFG 168
               SCOP domains d2ge3a1 A:6-169 Probable acetyltransferase Atu2290                                                                                                                   SCOP domains
               CATH domains 2ge3A00 A:6-169  [code=3.40.630.30, no name defined]                                                                                                                 CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeee.hhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhh...eeeeee..eeeeeeeeee........eeeeeeee.hhhh..hhhhhhhhhhhhhhhhhh..eeeeeee..hhhhhhhhhhhh.eeeeeeeeeee....eeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2ge3 A   6 DTVTIKPIRAEHVESFHRALDAVSRERKYLSFLEAPPLEAVRAFVLDmIENDHPQFVAIADGDVIGWCDIRRQDRATRAHCGTLGmGILPAYRNKGLGARLmRRTLDAAHEFGLHRIELSVHADNARAIALYEKIGFAHEGRARDAVSIDGHYIDSLNmAIIFG 169
                                    15        25        35        45       |55        65        75        85     |  95       105 |     115       125       135       145       155       165    
                                                                          53-MSE                                91-MSE         107-MSE                                                  164-MSE 


Chain B from PDB  Type:PROTEIN  Length:163
 aligned with A9CI25_AGRFC | A9CI25 from UniProtKB/TrEMBL  Length:169

    Alignment length:163
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165   
         A9CI25_AGRFC     6 TVTIKPIRAEHVESFHRALDAVSRERKYLSFLEAPPLEAVRAFVLDMIENDHPQFVAIADGDVIGWCDIRRQDRATRAHCGTLGMGILPAYRNKGLGARLMRRTLDAAHEFGLHRIELSVHADNARAIALYEKIGFAHEGRARDAVSIDGHYIDSLNMAIIFG 168
               SCOP domains d2ge3b_ B: automated matches                                                                                                                                        SCOP domains
               CATH domains 2ge3B00 B:7-169  [code=3.40.630.30, no name defined]                                                                                                                CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee.hhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhh...eeeeee..eeeeeeeeee........eeeeeeee.hhhh..hhhhhhhhhhhhhhhhhh..eeeeeee..hhhhhhhhhhhh.eeeeeeeeeee....eeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2ge3 B   7 TVTIKPIRAEHVESFHRALDAVSRERKYLSFLEAPPLEAVRAFVLDmIENDHPQFVAIADGDVIGWCDIRRQDRATRAHCGTLGmGILPAYRNKGLGARLmRRTLDAAHEFGLHRIELSVHADNARAIALYEKIGFAHEGRARDAVSIDGHYIDSLNmAIIFG 169
                                    16        26        36        46      | 56        66        76        86    |   96       106|      116       126       136       146       156       166   
                                                                         53-MSE                                91-MSE         107-MSE                                                  164-MSE 


Chain C from PDB  Type:PROTEIN  Length:164
 aligned with A9CI25_AGRFC | A9CI25 from UniProtKB/TrEMBL  Length:169

    Alignment length:164
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164    
         A9CI25_AGRFC     5 DTVTIKPIRAEHVESFHRALDAVSRERKYLSFLEAPPLEAVRAFVLDMIENDHPQFVAIADGDVIGWCDIRRQDRATRAHCGTLGMGILPAYRNKGLGARLMRRTLDAAHEFGLHRIELSVHADNARAIALYEKIGFAHEGRARDAVSIDGHYIDSLNMAIIFG 168
               SCOP domains d2ge3c_ C: automated matches                                                                                                                                         SCOP domains
               CATH domains 2ge3C00 C:6-169  [code=3.40.630.30, no name defined]                                                                                                                 CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeee.hhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhh...eeeeee..eeeeeeeeee..hhhhh.eeeeeeee.hhhh..hhhhhhhhhhhhhhhhhh..eeeeeee..hhhhhhhhhhhh.eeeeeeeeeeee..eeeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2ge3 C   6 DTVTIKPIRAEHVESFHRALDAVSRERKYLSFLEAPPLEAVRAFVLDmIENDHPQFVAIADGDVIGWCDIRRQDRATRAHCGTLGmGILPAYRNKGLGARLmRRTLDAAHEFGLHRIELSVHADNARAIALYEKIGFAHEGRARDAVSIDGHYIDSLNmAIIFG 169
                                    15        25        35        45       |55        65        75        85     |  95       105 |     115       125       135       145       155       165    
                                                                          53-MSE                                91-MSE         107-MSE                                                  164-MSE 


Chain D from PDB  Type:PROTEIN  Length:164
 aligned with A9CI25_AGRFC | A9CI25 from UniProtKB/TrEMBL  Length:169

    Alignment length:164
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165    
         A9CI25_AGRFC     6 TVTIKPIRAEHVESFHRALDAVSRERKYLSFLEAPPLEAVRAFVLDMIENDHPQFVAIADGDVIGWCDIRRQDRATRAHCGTLGMGILPAYRNKGLGARLMRRTLDAAHEFGLHRIELSVHADNARAIALYEKIGFAHEGRARDAVSIDGHYIDSLNMAIIFGN 169
               SCOP domains d2ge3d_ D: automated matches                                                                                                                                         SCOP domains
               CATH domains 2ge3D00 D:7-170  [code=3.40.630.30, no name defined]                                                                                                                 CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee.hhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhh...eeeeee..eeeeeeeeee..hhhhh.eeeeeeee.hhhh..hhhhhhhhhhhhhhhhh...eeeeeee..hhhhhhhhhhh..eeeeeeeeeeee..eeeeeeeeeee... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2ge3 D   7 TVTIKPIRAEHVESFHRALDAVSRERKYLSFLEAPPLEAVRAFVLDmIENDHPQFVAIADGDVIGWCDIRRQDRATRAHCGTLGmGILPAYRNKGLGARLmRRTLDAAHEFGLHRIELSVHADNARAIALYEKIGFAHEGRARDAVSIDGHYIDSLNmAIIFGN 170
                                    16        26        36        46      | 56        66        76        86    |   96       106|      116       126       136       146       156       166    
                                                                         53-MSE                                91-MSE         107-MSE                                                  164-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 4)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (1, 4)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2GE3)

(-) Gene Ontology  (2, 2)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (A9CI25_AGRFC | A9CI25)
molecular function
    GO:0008080    N-acetyltransferase activity    Catalysis of the transfer of an acetyl group to a nitrogen atom on the acceptor molecule.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ACO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ala D:40 - Pro D:41   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2ge3
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A9CI25_AGRFC | A9CI25
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  A9CI25_AGRFC | A9CI25
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2GE3)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2GE3)