|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 7)| Asymmetric/Biological Unit (3, 7) |
Sites (7, 7)
Asymmetric Unit (7, 7)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2GCN) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2GCN) |
SAPs(SNPs)/Variants (1, 1)
Asymmetric/Biological Unit (1, 1)
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2GCN) |
Exons (4, 4)
Asymmetric/Biological Unit (4, 4)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:177 aligned with RHOC_HUMAN | P08134 from UniProtKB/Swiss-Prot Length:193 Alignment length:177 12 22 32 42 52 62 72 82 92 102 112 122 132 142 152 162 172 RHOC_HUMAN 3 AIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGL 179 SCOP domains d2gcna_ A: RhoC SCOP domains CATH domains 2gcnA00 A:3-179 P-loop containing nucleotide triphosphate hydrolases CATH domains Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------H----------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript 1 (1) Exon 1.4a PDB: A:3-52 UniProt: 1-52 [INCOMPLETE] Exon 1.6b PDB: A:53-93 UniProt: 53-93 -------------------------------------------Exon 1.7k PDB: A:137-179 UniProt: 137-193 Transcript 1 (1) Transcript 1 (2) ------------------------------------------------------------------------------------------Exon 1.6g PDB: A:93-136 UniProt: 93-136 ------------------------------------------- Transcript 1 (2) 2gcn A 3 AIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGL 179 12 22 32 42 52 62 72 82 92 102 112 122 132 142 152 162 172
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (1, 1)
Asymmetric/Biological Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2GCN) |
Gene Ontology (18, 18)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (RHOC_HUMAN | P08134)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|