|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (1, 6)
|
(no "Site" information available for 2GBO) |
Asymmetric Unit
|
(no "Cis Peptide Bond" information available for 2GBO) |
(no "SAP(SNP)/Variant" information available for 2GBO) |
(no "PROSITE Motif" information available for 2GBO) |
(no "Exon" information available for 2GBO) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:82 aligned with Y2458_ENTFA | Q831P3 from UniProtKB/Swiss-Prot Length:101 Alignment length:82 10 20 30 40 50 60 70 80 Y2458_ENTFA 1 MDEGISKKFAIQLLEDDAERIKMLIRNQKNSLCISQCKAFEEVVDTQMYGFSRQVTYATRLGILTNDEGHRLLSDLERELNQ 82 SCOP domains d2gboa1 A:1-82 Hypothetical protein EF2458 SCOP domains CATH domains -2gboA00 A:2-82 Ferritin-like CATH domains Pfam domains ---------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------- Transcript 2gbo A 1 mDEGISKKFAIQLLEDDAERIKmLIRNQKNSLCISQCKAFEEVVDTQmYGFSRQVTYATRLGILTNDEGHRLLSDLERELNQ 82 | 10 20 | 30 40 |50 60 70 80 | 23-MSE 48-MSE 1-MSE Chain B from PDB Type:PROTEIN Length:82 aligned with Y2458_ENTFA | Q831P3 from UniProtKB/Swiss-Prot Length:101 Alignment length:82 10 20 30 40 50 60 70 80 Y2458_ENTFA 1 MDEGISKKFAIQLLEDDAERIKMLIRNQKNSLCISQCKAFEEVVDTQMYGFSRQVTYATRLGILTNDEGHRLLSDLERELNQ 82 SCOP domains d2gbob_ B: Hypothetical protein EF2458 SCOP domains CATH domains -2gboB00 B:2-82 Ferritin-like CATH domains Pfam domains ---------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------- Transcript 2gbo B 1 mDEGISKKFAIQLLEDDAERIKmLIRNQKNSLCISQCKAFEEVVDTQmYGFSRQVTYATRLGILTNDEGHRLLSDLERELNQ 82 | 10 20 | 30 40 |50 60 70 80 1-MSE 23-MSE 48-MSE
|
Asymmetric Unit |
Asymmetric Unit |
(no "Pfam Domain" information available for 2GBO) |
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 2GBO)
|
|
|
|
|
|
|