2G3P - JenaLib

Asym./Biol. Unit - manually (Jmol Viewer)

Asym./Biol. Unit (Jmol Viewer)

Title :   STRUCTURE OF THE N-TERMINAL TWO DOMAINS OF THE INFECTIVITY PROTEIN G3P OF FILAMENTOUS PHAGE FD

Authors :   P. Holliger, R. L. Williams

Date :   27 Oct 98 (Deposition) - 19 Jul 99 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.90

Chains :   Asym./Biol. Unit : A,B

Keywords :   Infection, Filamentous Phage, Pilus Binding, Beta Barrel, Conformational Change, Viral Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   P. Holliger, L. Riechmann, R. L. Williams
Crystal Structure Of The Two N-Terminal Domains Of G3P From Filamentous Phage Fd At 1. 9 A: Evidence For Conformational Lability.
J. Mol. Biol. V. 288 649 1999
PubMed-ID: 10329170 | Reference-DOI: 10.1006/JMBI.1999.2720
(for further references see the PDB file header)

Molecule 1 - INFECTIVITY PROTEIN G3P
	Chains	:	A, B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Cellular Location	:	PERIPLASM
	Expression System Plasmid	:	PUC119
	Expression System Strain	:	TG1
	Expression System Taxid	:	562
	Expression System Variant	:	LAC
	Expression System Vector Type	:	PLASMID
	Fragment	:	N-TERMINAL 2-DOMAIN FRAGMENT
	Organism Scientific	:	ENTEROBACTERIA PHAGE FD
	Organism Taxid	:	10864

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2G3P)

(no "Site" information available for 2G3P)

Asymmetric/Biological Unit

No.	Residues
1	A:7	-	A:36
2	A:46	-	A:53
3	A:188	-	A:201
4	B:7	-	B:36
5	B:46	-	B:53
6	B:188	-	B:201

Asymmetric/Biological Unit

No.	Residues
1	Asp A:160	-	Pro A:161
2	Gln A:212	-	Pro A:213
3	Asp B:160	-	Pro B:161
4	Gln B:212	-	Pro B:213

(no "SAP(SNP)/Variant" information available for 2G3P)

(no "PROSITE Motif" information available for 2G3P)

(no "Exon" information available for 2G3P)

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:201
 aligned with G3P_BPFD | P03661 from UniProtKB/Swiss-Prot  Length:424

    Alignment length:223
                                    29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239   
             G3P_BPFD    20 ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENEGGGSEGGGSEGGGSEGGGTKPPEYGDTPIPGYTYINPLDGTYPPGTEQNPANPNPSLEESQPLNTFMFQNNRFRNRQGALTVYTGTVTQGTDPVKTYYQYTPVSSKAMYDAYWNGKFRDCAFHSGFNEDPFVCEYQGQSSDLPQPPVNAGGGSGGG 242
               SCOP domains d2g3pa1 A:2-67 N-terminal domains of the minor coat protein g3p   ----------------------d2g3pa2 A:90-224 N-terminal domains of the minor coat protein g3p                                                                       SCOP domains
               CATH domains 2g3pA01 A:2-101,A:206-215 Phage FD Coat Protein,Membrane penetrati                      on domain   2g3pA02 A:102-205 Minor Coat Protein; Domain 2                                                          2g3pA01   --------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhh...eeeee............eeee..eeeeee..eee......eeeeeeeeee.....----------------------.......eeeeee.....................eee......eeee..eeeeee..eeeee..eeee.....eeeeeeee...hhhhhhhh.........................eeee........hhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2g3p A   2 ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPEN----------------------PEYGDTPIPGYTYINPLDGTYPPGTEQNPANPNPSLEESQPLNTFMFQNNRFRNRQGALTVYTGTVTQGTDPVKTYYQYTPVSSKAMYDAYWNGKFRDCAFHSGFNEDPFVCEYQGQSSDLPQPPVNAAAHHHHH 224
                                    11        21        31        41        51        61     |   -         -        91       101       111       121       131       141       151       161       171       181       191       201       211       221   
                                                                                            67                     90

Chain B from PDB  Type:PROTEIN  Length:201
 aligned with G3P_BPFD | P03661 from UniProtKB/Swiss-Prot  Length:424

    Alignment length:223
                                    29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239   
             G3P_BPFD    20 ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENEGGGSEGGGSEGGGSEGGGTKPPEYGDTPIPGYTYINPLDGTYPPGTEQNPANPNPSLEESQPLNTFMFQNNRFRNRQGALTVYTGTVTQGTDPVKTYYQYTPVSSKAMYDAYWNGKFRDCAFHSGFNEDPFVCEYQGQSSDLPQPPVNAGGGSGGG 242
               SCOP domains d2g3pb1 B:2-67 N-terminal domains of the minor coat protein g3p   ----------------------d2g3pb2 B:90-224 N-terminal domains of the minor coat protein g3p                                                                       SCOP domains
               CATH domains 2g3pB01 B:2-101,B:206-215 Phage FD Coat Protein,Membrane penetrati                      on domain   2g3pB02 B:102-205 Minor Coat Protein; Domain 2                                                          2g3pB01   --------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhh....eeeeee...........eeee..eeeeee..eee.....eeeeeeeeeee.....----------------------.......eeeeee.....................eee......eeee..eeeeee..eeeee..eeee.....eeeeeeee...hhhhhhhh.........................eeee.............. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2g3p B   2 ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPEN----------------------PEYGDTPIPGYTYINPLDGTYPPGTEQNPANPNPSLEESQPLNTFMFQNNRFRNRQGALTVYTGTVTQGTDPVKTYYQYTPVSSKAMYDAYWNGKFRDCAFHSGFNEDPFVCEYQGQSSDLPQPPVNAAAHHHHH 224
                                    11        21        31        41        51        61     |   -         -        91       101       111       121       131       141       151       161       171       181       191       201       211       221   
                                                                                            67                     90

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: N-terminal domains of the minor coat protein g3p (10)

Superfamily: N-terminal domains of the minor coat protein g3p (10)

Family: N-terminal domains of the minor coat protein g3p (5)

Protein domain: N-terminal domains of the minor coat protein g3p (4)

Bacteriophage fd [TaxId: 10864] (2)

1a	d2g3pa1	A:2-67
1b	d2g3pa2	A:90-224
1c	d2g3pb1	B:2-67
1d	d2g3pb2	B:90-224

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: Alpha-Beta Complex (3881)

Topology: Minor Coat Protein; domain 2 (4)

Homologous Superfamily: Minor Coat Protein; Domain 2 (4)

Enterobacteria phage fd. Organism_taxid: 10864. (1)

1a	2g3pA02	A:102-205
1b	2g3pB02	B:102-205

Class: Mainly Beta (13760)

Architecture: Roll (1513)

Topology: Phage FD Coat Protein, Membrane penetration domain (6)

Homologous Superfamily: Phage FD Coat Protein,Membrane penetration domain (6)

Enterobacteria phage fd. Organism_taxid: 10864. (2)

2a	2g3pA01	A:2-101,A:206-215
2b	2g3pB01	B:2-101,B:206-215

(no "Pfam Domain" information available for 2G3P)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (G3P_BPFD | P03661)

biological process
	GO:0009405	pathogenesis	The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
	GO:0046718	viral entry into host cell	The process that occurs after viral attachment by which a virus, or viral nucleic acid, breaches the plasma membrane or cell envelope and enters the host cell. The process ends when the viral nucleic acid is released into the host cell cytoplasm.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
	GO:0019076	viral release from host cell	The dissemination of mature viral particles from the host cell, e.g. by cell lysis or the budding of virus particles from the cell membrane.
	GO:0019062	virion attachment to host cell	The process by which a virion protein binds to molecules on the host cellular surface or host cell surface projection.
	GO:0039666	virion attachment to host cell pilus	The process by which a virion attaches to a host cell by binding to a pilus on the host cell surface. Pili are retractile filaments that protrude from gram-negative bacteria. Filamentous viruses can attach to the pilus tip, whereas icosahedral viruses can attach to the pilus side.
cellular component
	GO:0033644	host cell membrane	Double layer of lipid molecules as it encloses host cells, and, in eukaryotes, many organelles; may be a single or double lipid bilayer; also includes associated proteins. The host is defined as the larger of the organisms involved in a symbiotic interaction.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0019028	viral capsid	The protein coat that surrounds the infective nucleic acid in some virus particles. It comprises numerous regularly arranged subunits, or capsomeres.
	GO:0019012	virion	The complete fully infectious extracellular virus particle.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2g3p)

	Sites
(no "Sites" information available for 2g3p)

	Cis Peptide Bonds
		Asp A:160 - Pro A:161	[ RasMol ]
		Asp B:160 - Pro B:161	[ RasMol ]
		Gln A:212 - Pro A:213	[ RasMol ]
		Gln B:212 - Pro B:213	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2g3p
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	G3P_BPFD \| P03661
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	G3P_BPFD \| P03661
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	G3P_BPFD \| P03661	:	1fgp 3dgs 3knq

(no "Related Entries Specified in the PDB File" available for 2G3P)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (6, 6)

Cis Peptide Bonds (4, 4)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (2, 4)

Pfam Domains (0, 0)

Gene Ontology (11, 11)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File