|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (4, 5)| Asymmetric/Biological Unit (4, 5) |
Sites (5, 5)
Asymmetric Unit (5, 5)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2G3H) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2G3H) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2G3H) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2G3H) |
Exons (0, 0)| (no "Exon" information available for 2G3H) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:153 aligned with Q9VF15_DROME | Q9VF15 from UniProtKB/TrEMBL Length:153 Alignment length:153 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 Q9VF15_DROME 1 MNSDEVQLIKKTWEIPVATPTDSGAAILTQFFNRFPSNLEKFPFRDVPLEELSGNARFRAHAGRIIRVFDESIQVLGQDGDLEKLDEIWTKIAVSHIPRTVSKESYNQLKGVILDVLTAACSLDESQAATWAKLVDHVYGIIFKAIDDDGNAK 153 SCOP domains d2g3ha_ A: automated matches SCOP domains CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 2g3h A 1 MNSDEVQLIKKTWEIPVATPTDSGAAILTQFFNRFPSNLEKFPFRDVPLEELSGNARFRAHAGRIIRVFDESIQVLGQDGDLEKLDEIWTKIAVSHIPRTVSKESYNQLKGVILDVLTAASSLDESQAATWAKLVDHVYGIIFKAIDDDGNAK 153 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2G3H) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2G3H) |
Gene Ontology (8, 8)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (Q9VF15_DROME | Q9VF15)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|