|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric/Biological Unit (4, 27) |
Asymmetric Unit (7, 7)
|
(no "SS Bond" information available for 2FTR) |
(no "Cis Peptide Bond" information available for 2FTR) |
(no "SAP(SNP)/Variant" information available for 2FTR) |
(no "PROSITE Motif" information available for 2FTR) |
(no "Exon" information available for 2FTR) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:103 aligned with Q9KGB0_BACHD | Q9KGB0 from UniProtKB/TrEMBL Length:107 Alignment length:103 13 23 33 43 53 63 73 83 93 103 Q9KGB0_BACHD 4 ENMMVKLIALYEQPEDKQAFDEHYFNTHAPLTRKIPGLRDMKVTRIVGSPMGESKFYLMCEMYYDDHESLQQAMRTDEGKASGKDAMKFAGKLLTLMIGEEMD 106 SCOP domains d2ftra1 A:4-106 Hypothetical protein BH0200 SCOP domains CATH domains 2ftrA00 A:4-106 [code=3.30.70.900, no name defined] CATH domains Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------- Transcript 2ftr A 4 ENmmVKLIALYEQPEDKQAFDEHYFNTHAPLTRKIPGLRDmKVTRIVGSPmGESKFYLmCEmYYDDHESLQQAmRTDEGKASGKDAmKFAGKLLTLmIGEEmD 106 || 13 23 33 43| 53| 63 | 73 | 83 | 93 |103 | || 44-MSE 54-MSE 62-MSE 77-MSE 90-MSE 100-MSE| 6-MSE 65-MSE 105-MSE 7-MSE Chain B from PDB Type:PROTEIN Length:100 aligned with Q9KGB0_BACHD | Q9KGB0 from UniProtKB/TrEMBL Length:107 Alignment length:100 15 25 35 45 55 65 75 85 95 105 Q9KGB0_BACHD 6 MMVKLIALYEQPEDKQAFDEHYFNTHAPLTRKIPGLRDMKVTRIVGSPMGESKFYLMCEMYYDDHESLQQAMRTDEGKASGKDAMKFAGKLLTLMIGEEM 105 SCOP domains d2ftrb_ B: Hypothetical protein BH0200 SCOP domains CATH domains --2ftrB00 B:8-104 [code=3.30.70.900, no name defined] - CATH domains Pfam domains ---------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------- Transcript 2ftr B 6 mmVKLIALYEQPEDKQAFDEHYFNTHAPLTRKIPGLRDmKVTRIVGSPmGESKFYLmCEmYYDDHESLQQAmRTDEGKASGKDAmKFAGKLLTLmIGEEm 105 || 15 25 35 45 55 | 65 75 | 85 | 95 | 105 || 44-MSE 54-MSE 62-MSE 77-MSE 90-MSE 100-MSE| 6-MSE 65-MSE 105-MSE 7-MSE
|
Asymmetric/Biological Unit |
Asymmetric/Biological Unit |
(no "Pfam Domain" information available for 2FTR) |
Asymmetric/Biological Unit(hide GO term definitions)
(no "Gene Ontology" information available for 2FTR)
|
|
|
|
|
|
|