|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric/Biological Unit (1, 1)
|
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2FTB) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2FTB) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2FTB) |
PROSITE Motifs (1, 1)
Asymmetric/Biological Unit (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2FTB) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:125 aligned with FABP2_AMBME | P81400 from UniProtKB/Swiss-Prot Length:126 Alignment length:125 11 21 31 41 51 61 71 81 91 101 111 121 FABP2_AMBME 2 PFNGTWQVYSQENYEAFLRAVGLPEDIINVAKDINPIIEIQQNGDNFVVTSKTPNQSVTNSFTIGKEAEITSMGGKKIKCTVVLEGGKLVSKTDQFSHIQEVKGNEMVETLTVGGATLIRRSKRV 126 SCOP domains d2ftba_ A: automated matches SCOP domains CATH domains 2ftbA00 A:1-125 [code=2.40.128.20, no name defined] CATH domains Pfam domains ----------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---FABP PDB: A:4-21 -------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------------- Transcript 2ftb A 1 PFNGTWQVYSQENYEAFLRAVGLPEDIINVAKDINPIIEIQQNGDNFVVTSKTPNQSVTNSFTIGKEAEITSMGGKKIKCTVVLEGGKLVSKTDQFSHIQEVKGNEMVETLTVGGATLIRRSKRV 125 10 20 30 40 50 60 70 80 90 100 110 120
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (1, 1)| Asymmetric/Biological Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2FTB) |
Gene Ontology (5, 5)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (FABP2_AMBME | P81400)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|