Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF B-FORM BOMBYX MORI PHEROMONE BINDING PROTEIN
 
Authors :  C. Lautenschlager, W. S. Leal, J. Clardy
Date :  03 Jan 06  (Deposition) - 17 Jan 06  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Alpha Helical, Transport Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  C. Lautenschlager, W. S. Leal, J. Clardy
Coil-To-Helix Transition And Ligand Release Of Bombyx Mori Pheromone-Binding Protein.
Biochem. Biophys. Res. Commun. V. 335 1044 2005
PubMed-ID: 16111659  |  Reference-DOI: 10.1016/J.BBRC.2005.07.176
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PHEROMONE-BINDING PROTEIN
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GenePBP
    Organism CommonDOMESTIC SILKWORM
    Organism ScientificBOMBYX MORI
    Organism Taxid7091
    SynonymPBP

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2FJY)

(-) Sites  (0, 0)

(no "Site" information available for 2FJY)

(-) SS Bonds  (6, 6)

Asymmetric Unit
No.Residues
1A:19 -A:54
2A:50 -A:108
3A:97 -A:117
4B:19 -B:54
5B:50 -B:108
6B:97 -B:117

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2FJY)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2FJY)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2FJY)

(-) Exons   (0, 0)

(no "Exon" information available for 2FJY)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:136
 aligned with PBP_BOMMO | P34174 from UniProtKB/Swiss-Prot  Length:164

    Alignment length:136
                                    38        48        58        68        78        88        98       108       118       128       138       148       158      
            PBP_BOMMO    29 NLSLNFGKALDECKKEMTLTDAINEDFYNFWKEGYEIKNRETGCAIMCLSTKLNMLDPEGNLHHGNAMEFAKKHGADETMAQQLIDIVHGCEKSTPANDDKCIWTLGVATCFKAEIHKLNWAPSMDVAVGEILAEV 164
               SCOP domains d2fjya_ A: Moth pheromone-binding protein, PBP                                                                                           SCOP domains
               CATH domains 2fjyA00 A:7-142  [code=1.10.238.20, no name defined]                                                                                     CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhh....hhhhhhhhh........hhhhhhhhhhhhhhhhhh..........hhhhhhh...hhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2fjy A   7 NLSLNFGKALDECKKEMTLTDAINEDFYNFWKEGYEIKNRETGCAIMCLSTKLNMLDPEGNLHHGNAMEFAKKHGADETMAQQLIDIVHGCEKSTPANDDKCIWTLGVATCFKAEIHKLNWAPSMDVAVGEILAEV 142
                                    16        26        36        46        56        66        76        86        96       106       116       126       136      

Chain B from PDB  Type:PROTEIN  Length:142
 aligned with PBP_BOMMO | P34174 from UniProtKB/Swiss-Prot  Length:164

    Alignment length:142
                                    32        42        52        62        72        82        92       102       112       122       132       142       152       162  
            PBP_BOMMO    23 SQEVMKNLSLNFGKALDECKKEMTLTDAINEDFYNFWKEGYEIKNRETGCAIMCLSTKLNMLDPEGNLHHGNAMEFAKKHGADETMAQQLIDIVHGCEKSTPANDDKCIWTLGVATCFKAEIHKLNWAPSMDVAVGEILAEV 164
               SCOP domains d2fjyb_ B: Moth pheromone-binding protein, PBP                                                                                                 SCOP domains
               CATH domains 2fjyB00 B:1-142  [code=1.10.238.20, no name defined]                                                                                           CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........hhhhhhhhhhhh....hhhhhhhhh........hhhhhhhhhhhh.hhhhhh.........hhhhhhh...hhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2fjy B   1 SQEVMKNLSLNFGKALDECKKEMTLTDAINEDFYNFWKEGYEIKNRETGCAIMCLSTKLNMLDPEGNLHHGNAMEFAKKHGADETMAQQLIDIVHGCEKSTPANDDKCIWTLGVATCFKAEIHKLNWAPSMDVAVGEILAEV 142
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140  

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (1, 2)

Asymmetric Unit

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2FJY)

(-) Gene Ontology  (4, 4)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (PBP_BOMMO | P34174)
molecular function
    GO:0005549    odorant binding    Interacting selectively and non-covalently with an odorant, any substance capable of stimulating the sense of smell.
    GO:0005550    pheromone binding    Interacting selectively and non-covalently with a pheromone, a substance, or characteristic mixture of substances, that is secreted and released by an organism and detected by a second organism of the same or a closely related species, in which it causes a specific reaction, such as a definite behavioral reaction or a developmental process.
biological process
    GO:0019236    response to pheromone    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a pheromone stimulus.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2fjy)
 
  Sites
(no "Sites" information available for 2fjy)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2fjy)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2fjy
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PBP_BOMMO | P34174
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  PBP_BOMMO | P34174
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PBP_BOMMO | P341741dqe 1gm0 1ls8 1xfr 2p70 2p71

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2FJY)