Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  FASCIOLA HEPATICA GLUTATHIONE S-TRANSFERASE ISOFORM 1 IN COMPLEX WITH GLUTATHIONE
 
Authors :  G. Polekhina, J. Rossjohn, S. C. Feil, M. W. Parker
Date :  21 Oct 98  (Deposition) - 28 Oct 98  (Release) - 21 Dec 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Transferase-Substrate Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. Rossjohn, S. C. Feil, M. C. Wilce, J. L. Sexton, T. W. Spithill, M. W. Parker
Crystallization, Structural Determination And Analysis Of A Novel Parasite Vaccine Candidate: Fasciola Hepatica Glutathione S-Transferase.
J. Mol. Biol. V. 273 857 1997
PubMed-ID: 9367777  |  Reference-DOI: 10.1006/JMBI.1997.1338

(-) Compounds

Molecule 1 - GLUTATHIONE S-TRANSFERASE
    Chains: A, B
    EC Number: 2.5.1.18
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Expression System Vector: PTTQ18R
    Organism Common: LIVER FLUKE
    Organism Scientific: FASCIOLA HEPATICA
    Organism Taxid: 6192
    Synonym: GST

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric/Biological Unit (1, 2)
No.NameCountTypeFull Name
1GSH2Ligand/IonGLUTATHIONE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETYR A:6 , TRP A:7 , LEU A:12 , TRP A:40 , PHE A:41 , LYS A:44 , ASN A:53 , LEU A:54 , PRO A:55 , GLN A:66 , SER A:67 , HOH A:220 , HOH A:248 , HOH A:283 , HOH A:322 , ASP B:100 , HOH B:266BINDING SITE FOR RESIDUE GSH A 233
2AC2SOFTWAREASP A:100 , TYR B:6 , TRP B:7 , TRP B:40 , PHE B:41 , LYS B:44 , ASN B:53 , LEU B:54 , PRO B:55 , GLN B:66 , SER B:67 , HOH B:218 , HOH B:237 , HOH B:257 , HOH B:286BINDING SITE FOR RESIDUE GSH B 233

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2FHE)

(-) Cis Peptide Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1Leu A:54 -Pro A:55
2Trp A:200 -Pro A:201
3Leu B:54 -Pro B:55
4Trp B:200 -Pro B:201

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2FHE)

(-) PROSITE Motifs  (1, 2)

Asymmetric/Biological Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1GST_CTERPS50405 Soluble glutathione S-transferase C-terminal domain profile.GST29_FASHE84-202
 		  2A:84-202
B:84-202

(-) Exons   (0, 0)

(no "Exon" information available for 2FHE)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:216
 aligned with GST29_FASHE | P56598 from UniProtKB/Swiss-Prot  Length:221

    Alignment length:216
                                                  24                                                                                                                                                                                                
                                                23 |                                                                                                                                                                                                
                                    11        21 | |    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210      
          GST29_FASHE     2 PAKLGYWKIRGLQQPVRLLLEY-GEKYEEQIYERDDGEKWFSKKFELGLDLPNLPYYIDDKCKLTQSLAILRYIADKHGMIGSTPEERARVSMIEGAAVDLRQGLSRISYDPKFEQLKEGYLKDLPTTMKMWSDFLGKNPYLRGTSVSHVDFMVYEALDAIRYLEPHCLDHFPNLQQFMSRIEALPSIKAYMESNRFIKWPLNGWHAQFGGGDAPP 216
               SCOP domains d2fhea2 A:1-80 Class alpha GST                                                  d2fhea1 A:81-216 Class alpha GST                                                                                                         SCOP domains
               CATH domains 2fheA01 A:1-80,A:186-212 Glutaredoxin                                           2fheA02 A:81-185  [code=1.20.1050.10, no name defined]                                                   2fheA01 A:1-80,A:186-212   ---- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeeee.....hhhhhhhhhhh...eeeeee...hhhhhhhhh...........eee....eeehhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhh....................... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------GST_CTER  PDB: A:84-202 UniProt: 84-202                                                                                -------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2fhe A   1 PAKLGYWKIRGLQQPVRLLLEYLGEKYEEQIYERDDGEKWFSKKFELGLDLPNLPYYIDDKCKLTQSLAILRYIADKHGMIGTTSEERARVSMIEGAAVDLRQGISRISYQPKFEQLKEGYLKDLPTTMKMWSDFLGKNPYLRGTSVSHVDFMVYEALDAIRYLEPHCLDHFPNLQQFMSRIEALPSIKAYMESNRFIKWPLNGWHAQFGGGDAPP 216
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210      


Chain B from PDB  Type:PROTEIN  Length:216
 aligned with GST29_FASHE | P56598 from UniProtKB/Swiss-Prot  Length:221

    Alignment length:216
                                                  24                                                                                                                                                                                                
                                                23 |                                                                                                                                                                                                
                                    11        21 | |    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210      
          GST29_FASHE     2 PAKLGYWKIRGLQQPVRLLLEY-GEKYEEQIYERDDGEKWFSKKFELGLDLPNLPYYIDDKCKLTQSLAILRYIADKHGMIGSTPEERARVSMIEGAAVDLRQGLSRISYDPKFEQLKEGYLKDLPTTMKMWSDFLGKNPYLRGTSVSHVDFMVYEALDAIRYLEPHCLDHFPNLQQFMSRIEALPSIKAYMESNRFIKWPLNGWHAQFGGGDAPP 216
               SCOP domains d2fheb2 B:1-80 Class alpha GST                                                  d2fheb1 B:81-216 Class alpha GST                                                                                                         SCOP domains
               CATH domains 2fheB01 B:1-80,B:186-212 Glutaredoxin                                           2fheB02 B:81-185  [code=1.20.1050.10, no name defined]                                                   2fheB01 B:1-80,B:186-212   ---- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeeee.....hhhhhhhhhhh...eeeeee...hhhhhhh.............eee....eeehhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhh....................... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------GST_CTER  PDB: B:84-202 UniProt: 84-202                                                                                -------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2fhe B   1 PAKLGYWKIRGLQQPVRLLLEYLGEKYEEQIYERDDGEKWFSKKFELGLDLPNLPYYIDDKCKLTQSLAILRYIADKHGMIGTTSEERARVSMIEGAAVDLRQGISRISYQPKFEQLKEGYLKDLPTTMKMWSDFLGKNPYLRGTSVSHVDFMVYEALDAIRYLEPHCLDHFPNLQQFMSRIEALPSIKAYMESNRFIKWPLNGWHAQFGGGDAPP 216
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 4)

Asymmetric/Biological Unit
(-)
Class: All alpha proteins (14657)
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (2, 4)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2FHE)

(-) Gene Ontology  (3, 3)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (GST29_FASHE | P56598)
molecular function
    GO:0004364    glutathione transferase activity    Catalysis of the reaction: R-X + glutathione = H-X + R-S-glutathione. R may be an aliphatic, aromatic or heterocyclic group; X may be a sulfate, nitrile or halide group.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    GSH  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Leu A:54 - Pro A:55   [ RasMol ]  
    Leu B:54 - Pro B:55   [ RasMol ]  
    Trp A:200 - Pro A:201   [ RasMol ]  
    Trp B:200 - Pro B:201   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2fhe
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  GST29_FASHE | P56598
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.5.1.18
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  GST29_FASHE | P56598
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2FHE)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2FHE)