|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 4)
Asymmetric/Biological Unit (1, 4)
|
Sites (0, 0)| (no "Site" information available for 2FFM) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2FFM) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2FFM) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2FFM) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2FFM) |
Exons (0, 0)| (no "Exon" information available for 2FFM) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:83 aligned with A0A0H3JRL4_S | A0A0H3JRL4 from UniProtKB/TrEMBL Length:83 Alignment length:83 10 20 30 40 50 60 70 80 A0A0H3JRL4_S 1 MKIISISETPNHNTMKITLSESREGMTSDTYTKVDDSQPAFINDILKVEGVKSIFHVMDFISVDKENDANWETVLPKVEAVFE 83 SCOP domains d2ffma_ A: automated matches SCOP domains CATH domains -2ffmA00 A:2-83 Hypothetical protein SAV1430 CATH domains Pfam domains ----------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------- Transcript 2ffm A 1 mKIISISETPNHNTmKITLSESREGmTSDTYTKVDDSQPAFINDILKVEGVKSIFHVmDFISVDKENDANWETVLPKVEAVFE 83 | 10 | 20 | 30 40 50 |60 70 80 | 15-MSE 26-MSE 58-MSE 1-MSE
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (1, 1)
Asymmetric/Biological Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2FFM) |
Gene Ontology (0, 0)|
Asymmetric/Biological Unit(hide GO term definitions)
(no "Gene Ontology" information available for 2FFM)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|