Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  COMPLEX OF ENZYME IIAMTL AND PHOSPHORYLATED ENZYME IIBMTL FROM ESCHERICHIA COLI NMR, RESTRAINED REGULARIZED MEAN STRUCTURE
 
Authors :  G. M. Clore, J. Y. Suh
Date :  16 Dec 05  (Deposition) - 07 Feb 06  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A,B
Keywords :  Phosphotransferase, Transferase, Kinase, Sugar Transport, Complex (Transferase/Phosphocarrier) (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. Y. Suh, M. Cai, D. C. Williams Jr. , G. M. Clore
Solution Structure Of A Post-Transition State Analog Of The Phosphotransfer Reaction Between The A And B Cytoplasmic Domains Of The Mannitol Transporter Iimannitol Of The Escherichia Coli Phosphotransferase System
J. Biol. Chem. V. 281 8939 2006
PubMed-ID: 16443929  |  Reference-DOI: 10.1074/JBC.M513466200
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PTS SYSTEM MANNITOL-SPECIFIC EIICBA COMPONENT
    ChainsA
    EC Number2.7.1.69
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    FragmentEIIA-MTL, PHOSPHOTRANSFERASE ENZYME II, A DOMAIN COMPONENT
    GeneMTLA
    MutationYES
    Organism ScientificESCHERICHIA COLI
    Organism Taxid562
    StrainGI698
 
Molecule 2 - MANNITOL-SPECIFIC PTS SYSTEM ENZYME IIABC COMPONENTS
    ChainsB
    EC Number2.7.1.69
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    FragmentEIIB-MTL, PHOSPHOTRANSFERASE ENZYME II, B DOMAIN COMPONENT
    MutationYES
    Organism Taxid83334
    StrainGI698

 Structural Features

(-) Chains, Units

  
NMR Structure 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

NMR Structure (1, 1)
No.NameCountTypeFull Name
1SEP1Mod. Amino AcidPHOSPHOSERINE

(-) Sites  (0, 0)

(no "Site" information available for 2FEW)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2FEW)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2FEW)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2FEW)

(-) PROSITE Motifs  (3, 3)

NMR Structure (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PTS_EIIB_TYPE_2PS51099 PTS_EIIB type-2 domain profile.PTM3C_ECOLI378-473  1B:378-471
2PTS_EIIA_TYPE_2PS51094 PTS_EIIA type-2 domain profile.PTM3C_ECOLI494-636  1A:5-147
3PTS_EIIA_TYPE_2_HISPS00372 PTS EIIA domains phosphorylation site signature 2.PTM3C_ECOLI539-555  1A:50-66

(-) Exons   (0, 0)

(no "Exon" information available for 2FEW)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:144
 aligned with PTM3C_ECOLI | P00550 from UniProtKB/Swiss-Prot  Length:637

    Alignment length:144
                                   502       512       522       532       542       552       562       572       582       592       602       612       622       632    
          PTM3C_ECOLI   493 LFKLGAENIFLGRKAATKEEAIRFAGEQLVKGGYVEPEYVQAMLDREKLTPTYLGESIAVPHGTVEAKDRVLKTGVVFCQYPEGVRFGEEEDDIARLVIGIAARNNEHIQVITSLTNALDDESVIERLAHTTSVDEVLELLAGR 636
               SCOP domains d2fewa_ A: Phosphotransferase IIa-mannitol                                                                                                       SCOP domains
               CATH domains 2fewA00 A:4-147 Mannitol-specific EII; Chain A                                                                                                   CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....hhh.ee......hhhhhhhhhhhhhhhh.....hhhhhhhhhhhhh.......ee....hhhhhhhh...eeeeeeeeeeee.......eeeeeeeeehhhhhhhhhhhhhhhhh.hhhhhhhhhhh.hhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) -PTS_EIIA_TYPE_2  PDB: A:5-147 UniProt: 494-636                                                                                                  PROSITE (1)
                PROSITE (2) ----------------------------------------------PTS_EIIA_TYPE_2_H--------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2few A   4 LFKLGAENIFLGRKAATKEEAIRFAGEQLVKGGYVEPEYVQAMLDREKLTPTYLGESIAVPQGTVEAKDRVLKTGVVFCQYPEGVRFGEEEDDIARLVIGIAARNNEHIQVITSLTNALDDESVIERLAHTTSVDEVLELLAGR 147
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143    

Chain B from PDB  Type:PROTEIN  Length:97
 aligned with PTM3C_ECOLI | P00550 from UniProtKB/Swiss-Prot  Length:637

    Alignment length:97
                                   384       394       404       414       424       434       444       454       464       
          PTM3C_ECOLI   375 SHVRKIIVACDAGMGSSAMGAGVLRKKIQDAGLSQISVTNSAINNLPPDVDLVITHRDLTERAMRQVPQAQHISLTNFLDSGLYTSLTERLVAAQRH 471
               SCOP domains d2fewb_ B: automated matches                                                                      SCOP domains
               CATH domains 2fewB00 B:375-471 PTS system, Lactose/Cellobiose specific IIB subunit (Pfam 02302)                CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeee....hhhhhhhhhhhhhhhhh.....eeeeee.........eeeeehhhhhhhhhhh...eeeee....hhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ---PTS_EIIB_TYPE_2  PDB: B:378-471 UniProt: 378-473                                               PROSITE (1)
                PROSITE (2) ------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------- Transcript
                 2few B 375 SHVRKIIVAsDAGMGSSAMGAGVLRKKIQDAGLSQISVTNSAINNLPPDVDLVITHRDLTERAMRQVPQAQHISLTNFLDSGLYTSLTERLVAAQRH 471
                                   384       394       404       414       424       434       444       454       464       
                                   384-SEP                                                                                   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 2)

NMR Structure

(-) CATH Domains  (2, 2)

NMR Structure
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2FEW)

(-) Gene Ontology  (16, 16)

NMR Structure(hide GO term definitions)
Chain A,B   (PTM3C_ECOLI | P00550)
molecular function
    GO:0016301    kinase activity    Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
    GO:0022872    protein-N(PI)-phosphohistidine-mannitol phosphotransferase system transmembrane transporter activity    Catalysis of the PEP-dependent, phosphoryl transfer-driven transport of substances across a membrane. The transport happens by catalysis of the reaction: protein N-phosphohistidine + mannitol(out) = protein histidine + mannitol phosphate(in). This differs from primary and secondary active transport in that the solute is modified during transport.
    GO:0008982    protein-N(PI)-phosphohistidine-sugar phosphotransferase activity    Catalysis of the PEP-dependent, phosphoryl transfer-driven transport of substances across a membrane. The transport happens by catalysis of the reaction: protein N-phosphohistidine + sugar(out) = protein histidine + sugar phosphate(in). This differs from primary and secondary active transport in that the solute is modified during transport.
    GO:0090565    protein-phosphocysteine-mannitol phosphotransferase system transporter activity    Catalysis of the PEP-dependent, phosphoryl transfer-driven transport of substances across a membrane. The transport happens by catalysis of the reaction: protein S-phosphocysteine + mannitol(out) = protein cysteine + mannitol phosphate(in). This differs from primary and secondary active transport in that the solute is modified during transport.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0005215    transporter activity    Enables the directed movement of substances (such as macromolecules, small molecules, ions) into, out of or within a cell, or between cells.
biological process
    GO:0034219    carbohydrate transmembrane transport    The process in which a carbohydrate is transported from one side of a membrane to the other by means of some agent such as a transporter or pore.
    GO:0008643    carbohydrate transport    The directed movement of carbohydrate into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Carbohydrates are any of a group of organic compounds based of the general formula Cx(H2O)y.
    GO:0015797    mannitol transport    The directed movement of mannitol into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Mannitol is the alditol derived from D-mannose by reduction of the aldehyde group.
    GO:0009401    phosphoenolpyruvate-dependent sugar phosphotransferase system    The uptake and phosphorylation of specific carbohydrates from the extracellular environment; uptake and phosphorylation are coupled, making the PTS a link between the uptake and metabolism of sugars; phosphoenolpyruvate is the original phosphate donor; phosphoenolpyruvate passes the phosphate via a signal transduction pathway, to enzyme 1 (E1), which in turn passes it on to the histidine protein, HPr; the next step in the system involves sugar-specific membrane-bound complex, enzyme 2 (EII), which transports the sugar into the cell; it includes the sugar permease, which catalyzes the transport reactions; EII is usually divided into three different domains, EIIA, EIIB, and EIIC.
    GO:0016310    phosphorylation    The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005887    integral component of plasma membrane    The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    SEP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 2few)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2few)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2few
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PTM3C_ECOLI | P00550
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.1.69
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  PTM3C_ECOLI | P00550
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PTM3C_ECOLI | P005501a3a 1j6t 1vkr 1vrv

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2FEW)