2F5I - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Title :   X-RAY STRUCTURE OF SPERMIDINE/SPERMINE N1-ACETYLTRANSFERASE (SAT) FROM HOMO SAPIENS

Authors :   Y. Q. Zhu, D. Y. Zhu, C. Vonrhein, D. C. Wang

Date :   25 Nov 05 (Deposition) - 06 Dec 05 (Release) - 25 Mar 08 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.30

Chains :   Asym./Biol. Unit : A,B

Keywords :   Beta-Alpha-Barrels, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   Y. Q. Zhu, D. Y. Zhu, L. Yin, Y. Zhang, C. Vonrhein, D. C. Wang
Crystal Structure Of Human Spermidine/Spermine N1-Acetyltransferase (Hssat): The First Structure Of A New Sequence Family Of Transferase Homologous Superfamily
Proteins V. 63 1127 2006
PubMed-ID: 16544326 | Reference-DOI: 10.1002/PROT.20965
(for further references see the PDB file header)

Molecule 1 - DIAMINE ACETYLTRANSFERASE 1
	Chains	:	A, B
	EC Number	:	2.3.1.57
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	PET22B(+)
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	T7 PROMOTER
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	SPERMIDINE/SPERMINE N1-ACETYLTRANSFERASE, SAT, SPERMIDINE/SPERMINE N(1)-ACETYLTRANSFERASE 1, SSAT, SSAT-1, PUTRESCINE ACETYLTRANSFERASE, POLYAMINE N- ACETYLTRANSFERASE 1

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2F5I)

(no "Site" information available for 2F5I)

(no "SS Bond" information available for 2F5I)

Asymmetric/Biological Unit

No.	Residues
1	Thr B:65	-	Pro B:66

(no "SAP(SNP)/Variant" information available for 2F5I)

Asymmetric/Biological Unit (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	GNAT	PS51186	Gcn5-related N-acetyltransferase (GNAT) domain profile.	SAT1_HUMAN	4-171	2	A:4-169 B:4-170

Asymmetric/Biological Unit (6, 12)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000379270	1a	ENSE00001480358	X:23801290-23801534	245	SAT1_HUMAN	1-22	22	2	A:3-22 B:3-22	20 20
1.2c	ENST00000379270	2c	ENSE00000893299	X:23801775-23801826	52	SAT1_HUMAN	23-40	18	2	A:23-40 B:23-40	18 18
1.2e	ENST00000379270	2e	ENSE00001330300	X:23801917-23802000	84	SAT1_HUMAN	40-68	29	2	A:40-68 B:40-68	29 29
1.3c	ENST00000379270	3c	ENSE00001292529	X:23803445-23803546	102	SAT1_HUMAN	68-102	35	2	A:68-102 B:68-102	35 35
1.3f	ENST00000379270	3f	ENSE00000893296	X:23803637-23803677	41	SAT1_HUMAN	102-115	14	2	A:102-115 B:102-115	14 14
1.4f	ENST00000379270	4f	ENSE00001917283	X:23803803-23804343	541	SAT1_HUMAN	116-171	56	2	A:116-169 B:116-170	54 55

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:167
 aligned with SAT1_HUMAN | P21673 from UniProtKB/Swiss-Prot  Length:171

    Alignment length:167
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       
           SAT1_HUMAN     3 KFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMAT 169
               SCOP domains d2f5ia1 A:3-169 Diamine acetyltransferase 1                                                                                                                             SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee.hhhhhhhhhhhhhhhhhhh........hhhhhhhhhh......eeeeee............eeeeeeeeeeee...eeeeeeeeeee.hhhh..hhhhhhhhhhhhhhhhh...eeeeeee..hhhhhhhhhhh..eehhhhhheeeeeeehhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -GNAT  PDB: A:4-169 UniProt: 4-171                                                                                                                                      PROSITE
           Transcript 1 (1) Exon 1.1a           Exon 1.2c         ---------------------------Exon 1.3c  PDB: A:68-102           -------------Exon 1.4f  PDB: A:116-169 UniProt: 116-171             Transcript 1 (1)
           Transcript 1 (2) -------------------------------------Exon 1.2e  PDB: A:40-68      ---------------------------------Exon 1.3f     ------------------------------------------------------ Transcript 1 (2)
                 2f5i A   3 KFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMAT 169
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162

Chain B from PDB  Type:PROTEIN  Length:168
 aligned with SAT1_HUMAN | P21673 from UniProtKB/Swiss-Prot  Length:171

    Alignment length:168
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162        
           SAT1_HUMAN     3 KFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATE 170
               SCOP domains d2f5ib_ B: automated matches                                                                                                                                             SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeee.hhhhhhhhhhhhhhhhhhh........hhhhhhhhhhh.....eeeeee............eeeeeeeeeeee...eeeeeeeeeee.hhhh..hhhhhhhhhhhhhhhhh...eeeeeee..hhhhhhhhh....eehhhhhheeeeeeehhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE -GNAT  PDB: B:4-170 UniProt: 4-171                                                                                                                                       PROSITE
           Transcript 1 (1) Exon 1.1a           Exon 1.2c         ---------------------------Exon 1.3c  PDB: B:68-102           -------------Exon 1.4f  PDB: B:116-170 UniProt: 116-171 [INCOMPLETE] Transcript 1 (1)
           Transcript 1 (2) -------------------------------------Exon 1.2e  PDB: B:40-68      ---------------------------------Exon 1.3f     ------------------------------------------------------- Transcript 1 (2)
                 2f5i B   3 KFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATE 170
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: Acyl-CoA N-acyltransferases (Nat) (250)

Superfamily: Acyl-CoA N-acyltransferases (Nat) (250)

Family: N-acetyl transferase, NAT (154)

Protein domain: automated matches (23)

Human (Homo sapiens) [TaxId: 9606] (9)

d2f5ib_

Protein domain: Diamine acetyltransferase 1 (8)

Human (Homo sapiens) [TaxId: 9606] (8)

d2f5ia1

A:3-169

(no "CATH Domain" information available for 2F5I)

(no "Pfam Domain" information available for 2F5I)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (SAT1_HUMAN | P21673)

molecular function
	GO:0008080	N-acetyltransferase activity	Catalysis of the transfer of an acetyl group to a nitrogen atom on the acceptor molecule.
	GO:0004145	diamine N-acetyltransferase activity	Catalysis of the reaction: acetyl-CoA + an alkane-alpha,omega-diamine = CoA + an N-acetyldiamine.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
	GO:0016746	transferase activity, transferring acyl groups	Catalysis of the transfer of an acyl group from one compound (donor) to another (acceptor).
biological process
	GO:0001525	angiogenesis	Blood vessel formation when new vessels emerge from the proliferation of pre-existing blood vessels.
	GO:0006596	polyamine biosynthetic process	The chemical reactions and pathways resulting in the formation of polyamines, any organic compound containing two or more amino groups.
	GO:0009447	putrescine catabolic process	The chemical reactions and pathways resulting in the breakdown of putrescine, 1,4-diaminobutane; putrescine is the metabolic precursor of spermidine and spermine.
	GO:0042127	regulation of cell proliferation	Any process that modulates the frequency, rate or extent of cell proliferation.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2f5i)

	Sites
(no "Sites" information available for 2f5i)

	Cis Peptide Bonds
		Thr B:65 - Pro B:66	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2f5i
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	SAT1_HUMAN \| P21673
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.3.1.57
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	SAT1_HUMAN \| P21673
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	SAT1_HUMAN \| P21673	:	2b3u 2b3v 2b4b 2b4d 2b58 2b5g 2fxf 2g3t 2jev

(no "Related Entries Specified in the PDB File" available for 2F5I)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (1, 1)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 2)

Exons (6, 12)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 2)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (12, 12)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File