|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 7)| Asymmetric/Biological Unit (2, 7) |
Sites (5, 5)
Asymmetric Unit (5, 5)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2EWR) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2EWR) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2EWR) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2EWR) |
Exons (0, 0)| (no "Exon" information available for 2EWR) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:156 aligned with Q9X0A5_THEMA | Q9X0A5 from UniProtKB/TrEMBL Length:158 Alignment length:156 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 Q9X0A5_THEMA 2 IRPEYLRVLRKIYDRLKNEKVNWVVTGSLSFALQGVPVEVHDIDIQTDEEGAYEIERIFSEFVSKKVRFSSTEKICSHFGELIIDGIKVEIMGDIRKRLEDGTWEDPVDLNKYKRFVETHGMKIPVLSLEYEYQAYLKLGRVEKAETLRKWLNERK 157 SCOP domains d2ewra1 A:2-157 Hypothetical protein TM1012 SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript 2ewr A 2 IRPEYLRVLRKIYDRLKNEKVNWVVTGSLSFALQGVPVEVHDIDIQTDEEGAYEIERIFSEFVSKKVRFSSTEKICSHFGELIIDGIKVEImGDIRKRLEDGTWEDPVDLNKYKRFVETHGmKIPVLSLEYEYQAYLKLGRVEKAETLRKWLNERK 157 11 21 31 41 51 61 71 81 91 | 101 111 121 | 131 141 151 93-MSE 123-MSE
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric/Biological Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 2EWR) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2EWR) |
Gene Ontology (0, 0)|
Asymmetric/Biological Unit(hide GO term definitions)
(no "Gene Ontology" information available for 2EWR)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|